KEGG   Campylobacter jejuni subsp. jejuni IA3902: CJSA_1338Help
Entry
CJSA_1338         CDS       T01854                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cji  Campylobacter jejuni subsp. jejuni IA3902
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cji00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJSA_1338 (algC)
   00030 Pentose phosphate pathway
    CJSA_1338 (algC)
   00051 Fructose and mannose metabolism
    CJSA_1338 (algC)
   00052 Galactose metabolism
    CJSA_1338 (algC)
   00500 Starch and sucrose metabolism
    CJSA_1338 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CJSA_1338 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CJSA_1338 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CJSA_1338 (algC)
Enzymes [BR:cji01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CJSA_1338 (algC)
    5.4.2.8  phosphomannomutase
     CJSA_1338 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1344992..1346362)
Genome map
AA seq 456 aa AA seqDB search
MLDVIFREYDIRGLYGKELNEKSVKAIGFCLGQTMLNKGCKNVSVGYDARYSANELFNYL
VSGLNKAGIKIYDIGLVPTPLGYFSLYEGLKFDANVMITGSHNPKDYNGFKITINKESFF
GVELKEFSKEVYKHLDDDIEENLEVEKYDILSLYVKFMCEQFSFLKDFNYKFGVDCTNGA
AGVVIKPLIKALNLKAHVMFAKPDGQFPNHAPDPTEEENLSAIREFLNQNQDYSLAFAFD
GDADRMVALSKTYVFCGDELCYLFAKNIPNPRILGEVKCSKNLFDEVAKFGTIFMGKTGH
SNIKKMMKEKDIDLAAEVSGHIFFKHRYFGYDDGIYAFLRALELVYKGFDLESMIKALPK
LYTTPEIKIPVNEEEKFKLVEEFQKEIEKGALKGVKSLCEIDGARIDFGDGWALLRASNT
SPYLITRFEATSLERAKELESTVFSLFNEIKARLKN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtgatttttagagaatatgatataagagggctttatggcaaagaattaaat
gaaaaaagtgttaaggctataggtttttgcttgggacaaaccatgctaaataaaggctgt
aaaaatgtaagtgtgggctatgatgcaagatatagtgcaaatgaactttttaattatcta
gtgagtggacttaacaaagcgggaataaaaatctatgatatagggcttgtaccaactcca
ttgggatattttagtctttatgagggcttgaaatttgatgcaaatgttatgataacaggc
tctcataacccaaaagattataatggttttaaaatcactatcaataaagaaagttttttt
ggcgtggaattaaaagagttttcaaaagaagtttataagcatttagatgatgatattgaa
gaaaatttagaagtagaaaaatacgatattttaagcctttatgtgaaatttatgtgcgag
caatttagttttttaaaggattttaattataaatttggtgttgattgcacaaatggtgcg
gctggagtggtgataaagcctttaatcaaggctttaaatttaaaagctcatgtaatgttt
gcaaagcctgatggacagtttccaaaccatgctccagatcctacagaagaagaaaactta
agtgcgattagagagtttttaaatcaaaatcaagattattctttagcttttgcttttgat
ggggatgctgatagaatggttgctttgagtaaaacttatgtattttgtggagatgagctt
tgttatttgtttgctaaaaatattcctaatccacgcattttaggtgaggtaaaatgttct
aaaaatctttttgatgaagtggctaaatttggaactatttttatgggaaaaacaggacat
tctaatatcaaaaaaatgatgaaagaaaaagatattgatttagctgctgaagtgagtgga
catattttctttaaacatagatattttggttatgatgatggaatttacgcatttttaaga
gccttagaacttgtttataaaggttttgatttagaaagtatgattaaagctttaccaaaa
ctttatactacacctgaaattaaaattcctgtaaatgaagaagaaaaatttaaacttgtg
gaagaatttcaaaaagagattgaaaaaggagctttaaaaggtgttaaaagtctttgtgaa
attgatggagctaggatagattttggcgatggatgggctttgcttcgtgcatctaacacc
agcccttatcttatcacacgctttgaagcaacttctttagaaagagcaaaagagcttgaa
agtacggtatttagtttgtttaatgagataaaagctaggcttaagaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system