KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0047Help
Entry
CJJ81176_0047     CDS       T00461                                 

Gene name
ccpA-1
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Brite
Enzymes [BR:cjj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CJJ81176_0047 (ccpA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(25299..26213)
Genome map
AA seq 304 aa AA seqDB search
MKKIIMILCLSYANIVFAVDMITPIPNSISYDKEKAKLGKSLYMDKSLSKDGKVSCNTCH
RLDQHGVDGLEFSIGVDNQLDKPFNTPTTFNSVFNFVQFWNGRAKDLAEQATVPFFNPKE
MGLSPELLLQKVNSNENYVKTFKKLYGEVTVENIALAIAEFEKTLITPNSPFDRYLSGDQ
NAISAQAKKGYEDFKANGCISCHQGQNIGGNMFQKIGIFEEYPNQEDLGRYEITKREADK
MVFKVPSLRNIAKTAPYFHDGSIPTLDACVQFMAYYQLGKFLDQETVDNIVAFLESLTGE
YHDK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataataatgattttatgtttatcttatgcaaatatagtctttgcagtagat
atgataacccctattccaaattccatctcttatgataaagaaaaagctaaacttggaaaa
agtctttatatggataaaagtttatccaaagatggaaaagtttcgtgcaatacttgccat
aggcttgatcaacacggcgttgatggacttgaattttcaataggagttgataatcaactc
gataaaccctttaacactcctacaacctttaattctgtatttaattttgtgcaattttgg
aatggtagagctaaagatttagcagaacaagctacagtaccttttttcaatcctaaagaa
atggggctaagtcctgaacttcttttacaaaaagttaattcaaatgaaaattatgtaaaa
acttttaaaaaactttatggagaagttacggtagaaaacatagctcttgcaatcgccgaa
tttgaaaaaaccttgatcactccaaattctccttttgatcgctatcttagcggggatcaa
aatgctatttcagctcaagctaaaaaaggttacgaagattttaaagctaatggctgcatc
tcttgtcatcaaggtcaaaatataggtgggaatatgtttcaaaaaatcggtatttttgaa
gaatacccaaaccaagaagatttagggcgctatgaaatcacaaaaagagaagctgataaa
atggtatttaaagttcctagtcttagaaatatagccaaaaccgcaccttattttcatgat
ggatctatacctactttagatgcttgtgttcagtttatggcttactatcaactaggaaaa
tttttagatcaagaaacagttgacaatatagttgcattcttagaaagcttaacaggagaa
tatcatgacaaataa

DBGET integrated database retrieval system