KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0225Help
Entry
CJJ81176_0225     CDS       T00461                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CJJ81176_0225 (folE)
Enzymes [BR:cjj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CJJ81176_0225 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
195268..195840
Genome map
AA seq 190 aa AA seqDB search
MQKKFEDCVKTMLEIIGENPNREGLIKTPNRVFKTYEFLTSGYTQNVKEILNDALFESSN
NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLT
EQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFFS
LINSAKQVRF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaaaatttgaagattgtgttaaaactatgcttgaaattataggagaaaatcca
aatcgtgaagggcttattaaaacaccaaatcgtgtttttaaaacttatgaatttcttact
agtggttatacgcaaaatgtcaaagaaattttaaatgacgctttatttgaaagctctaat
aatgaaatggttttagtgcgtgatatagaattttatagtctttgcgaacatcatctttta
cctttttttgggcgtgctcatgtagcctatattcctaataaaaaagtagtaggtttaagc
aaaattccacgccttgtagaggtgtttgcaagaagacttcaaatccaagaacaactcacc
gaacaaatcgcacaagctttaatggaaaatgtcgatgcaaaaggtgtaggtgtagtcata
gaagcaagacatatgtgtgttgaaatgcgtggagtgcaaaaagctaattcaaccactaca
acttcagctttgcgtggaattttcttgaaaaatgaaaaaaccagagaggaatttttttct
ctcataaactctgctaaacaggtaagattttaa

DBGET integrated database retrieval system