KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0327Help
Entry
CJJ81176_0327     CDS       T00461                                 

Definition
hypothetical protein
Orthology
K09789  
biotin synthesis protein BioG
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Biotin metabolism
Metabolic pathways
Module
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CJJ81176_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(281630..282241)
Genome map
AA seq 203 aa AA seqDB search
MKISNLIQNENSQELILVFGGFASHPSHFAHLKSDKNVVLVYDYENLDFKFDLKSFSKIT
LIAFSMGVCVASRVLKDIEFSQKIAINGTPFGIDKLKGIHPAIFAKQIKKFDLTAFKKSL
FKERKNEAKNFIFKDEKDLKTELEKLFEFASKECNENFIWDKIYSSNNDEIFPQNALKNT
FSKLIFLNEPHFAFFHFKTWDEI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcaatttaattcaaaatgaaaactcacaagaacttatcttagtatttggc
ggttttgcttcacatcctagccattttgcacatttaaaaagcgataaaaatgtagttttg
gtttatgattatgaaaatttagactttaaatttgatttaaagtctttttctaaaatcact
ctcatagctttttctatgggagtttgcgtagcaagtagagttttaaaagatatagagttt
tcgcaaaaaatagctatcaatggcactccttttggcatagataaattaaaaggaattcat
cctgcaatttttgctaagcaaattaaaaaatttgatctcacggcttttaaaaaatcttta
tttaaagagcgcaaaaatgaagcaaaaaactttatttttaaagatgaaaaagatttaaaa
accgagcttgaaaaacttttcgaatttgcctcaaaagagtgtaatgaaaactttatttgg
gacaaaatttactcaagcaataatgatgaaatttttcctcaaaatgctttaaaaaacact
ttttcaaagcttattttcctaaatgagccacattttgctttttttcattttaaaacttgg
gatgaaatttga

DBGET integrated database retrieval system