KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0373Help
Entry
CJJ81176_0373     CDS       T00461                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CJJ81176_0373 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJJ81176_0373 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJJ81176_0373 (trpA)
Enzymes [BR:cjj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CJJ81176_0373 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
324018..324767
Genome map
AA seq 249 aa AA seqDB search
MVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIAD
AAKIALDQGMDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVP
ELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVE
EAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIM
KDIEEIFKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttagaaaattttataaagaaaatgcaaatgtggcttatacggttttaggt
tatccaaatcttcaaacaagtgaagcttttttgcaaagattggatcaaagccctattgat
attttagaacttggtgttgcttatagtgatcctattgccgatggtgagattattgcagat
gcggcaaaaatagctcttgatcaaggcatggatattcatagtgtttttgagcttttagct
aggataaaaactaaaaaagctttggtttttatggtttattataatttaattttttcttat
ggcttggaaaaatttgtgaaaaaagcaaaatctttagggatttgtgctttgattgtgcct
gaattgagttttgaagaaagtgatgatttaattaaagagtgtgaaagatataatatagct
ttaattacacttgtaagtgttacaacccctaaagaaagggttaaaaagttagtaaaacat
gctaaaggttttatttatttattagcaagcataggtattacaggtacgaaaagtgtcgaa
gaagcaatcttacaagataaagtaaaagaaatcagatcttttacaaatttgcctattttt
gtaggctttggcattcaaaataatcaagatgtaaaaagaatgagaaaagttgctgacgga
gtgattgtgggaactagcatagtaaagtgttttaaacaaggaaatttggatataataatg
aaagatattgaagaaattttcaaaaaataa

DBGET integrated database retrieval system