KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0382Help
Entry
CJJ81176_0382     CDS       T00461                                 

Gene name
ccpA-2
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Brite
Enzymes [BR:cjj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CJJ81176_0382 (ccpA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330036..331061
Genome map
AA seq 341 aa AA seqDB search
MKVKSLLIASLVAFSSLNAASLIDEAKNSGLVALPKDQKGVDEILKQNGVKASEFTLEKA
ELGKKLYFEPRLSKSGIISCNTCHNVGLGGTDGISTAIGHKWTANPHHLNSPTVYNAVLN
NTQFWDGRAGTLADQAKGPIQADPEMATPAKLAVEKISSLPEYVSEFKKIYGKSGVNFDN
IADAIANFERTLITPSRFDKFLEGDEKALTKEEQKGLKLFIDKGCVACHNGVNLGGNMQA
FEVAGKYKFANLGDFKGDANGMVKTPTLRNVAETAPYFHNGAIWNLKDAIKEMGSVQLGI
KISDKEAKSIETFLKSLTGTKPAIVYPQLPISTEKTPKPEL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaatcattgctaatcgcatccttagttgctttttcaagcttaaatgctgca
agtcttatagatgaagctaaaaattcaggtcttgttgccttaccaaaagatcaaaaaggc
gttgatgaaattttaaaacaaaatggagtaaaggctagtgaatttactcttgaaaaagca
gagcttggcaaaaagctctattttgaaccacgtctttcaaaaagtggtatcatttcttgt
aatacctgtcataatgtaggacttggtggaacagatggaatcagtactgcaataggtcat
aaatggacagcaaatcctcatcatttaaattcaccaacagtttataatgcagtcttaaat
aatactcaattttgggatggtcgtgcaggaacattagccgatcaagctaaaggtccaatc
caagctgatcctgaaatggcaactcctgctaaacttgcagtagaaaaaatttcatctttg
cctgaatatgtgagtgagtttaaaaaaatctatggtaaaagcggtgtaaattttgacaat
attgctgatgcaattgcaaattttgaaagaactttgatcactccatctcgttttgataaa
tttttagaaggcgatgaaaaagctttaacaaaagaagaacaaaaaggcttaaagcttttt
atagataaaggttgtgtagcttgtcataatggtgtgaatttaggtggcaatatgcaagcg
tttgaagttgctggtaaatataaatttgcaaatttaggtgattttaaaggtgatgcaaat
ggcatggtaaaaactccaactttaagaaatgttgctgaaactgctccatattttcataat
ggtgcgatttggaatttaaaagatgctattaaggaaatgggtagtgtgcaacttggcatt
aaaatttctgataaagaagcaaaaagtattgaaactttcttaaaatctttaacaggaaca
aaaccagcaattgtttatccacaacttcctatttctactgaaaaaactcctaaacctgaa
ctataa

DBGET integrated database retrieval system