KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0613Help
Entry
CJJ81176_0613     CDS       T00461                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CJJ81176_0613 (folP)
Enzymes [BR:cjj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CJJ81176_0613 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
541077..542219
Genome map
AA seq 380 aa AA seqDB search
MKFFKINPNTDFNLLCSFINPHKMGQKIMSEKTKIHFIFIKDISTPAANILKQDALRVGA
ELITHKEVITAKITHSNALLMASKEQIQKLIAKEKLQDFGLKNLALFLQKDFLKPKKAEL
MAVINVNEDSFNAKSRVSEEDFEKRLNDFLALKPEYIDIGAVSSRPGSEYCGKEEEFKRL
KKVLDLIYEKNYYEQAIFSLDSFDEYCLEYALNKGFKLINDITSLRNLNLAKLASKYGAK
YCLMHMQNNPNNMQDNPFYEDLLDEMTLFFKEKLELLESFGVKESILDVGIGFGKSAGHN
MILIKHLEHFLQFNKPLLIGASRKSVINAYFQSEIKDRLAGTLYLHLKAFENGASIIRVH
DLYEHKQLFALAQAMDNIGV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttaaaatcaatccaaacaccgattttaatttgctttgttctttcataaac
cctcataaaatgggacaaaagattatgagtgaaaaaacaaaaattcattttatttttatc
aaagatatttctactcctgcggcaaatattttaaaacaagatgctttaagagtaggagct
gaacttattactcataaagaagtaattactgcaaaaatcactcattcaaatgcactttta
atggcaagtaaagagcaaattcaaaagcttattgctaaagaaaaacttcaagattttgga
cttaaaaatttggctctttttttgcaaaaagattttttaaaaccaaaaaaagctgagctt
atggcagtgattaatgtcaatgaagacagttttaatgcaaaaagtcgtgtgagtgaagaa
gactttgaaaaaaggcttaatgactttcttgctttaaagcctgaatatatcgatataggt
gcggttagttcaagacctgggagtgagtattgtggtaaggaagaggaatttaaaagactg
aaaaaagtacttgacttaatttatgagaaaaattattacgaacaagcaatttttagttta
gatagttttgatgaatattgtctagaatatgctttaaataagggttttaaactcattaat
gatattacaagtttaagaaatcttaatctagccaaacttgcaagtaaatatggggcaaaa
tattgcttaatgcacatgcaaaacaatccaaataacatgcaagataatcctttttatgaa
gatttgcttgatgagatgactttgttttttaaagaaaaacttgagcttttggaaagtttt
ggagtaaaagaaagtattttagatgtgggtattggctttggaaagagtgcggggcataat
atgattttaatcaaacacttagaacattttttgcaatttaataaacctttacttataggt
gcgagtcgtaaaagtgtgattaatgcgtattttcaaagtgagattaaagatcgtttagcg
ggaactttgtatttgcatttaaaggcttttgaaaatggtgctagtattataagagtgcat
gatttatatgaacataaacaactttttgctttagcgcaggcaatggataatataggagtt
tag

DBGET integrated database retrieval system