KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0820Help
Entry
CJJ81176_0820     CDS       T00461                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cjj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(749426..749977)
Genome map
AA seq 183 aa AA seqDB search
MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKF
YGFLDKDEQKMFEMLLKVNGVGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKS
AKRIIVELSDTKTKLENVSDDKSEALAALLTLGFKQEKIISVLASAQATGTSELIKEALK
KLG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggcatcgaaggaataatcacaaaaaaagaacctacttttatcattgttaaa
tgtgctagtggtttaagctatgggatatttatttcgcttttttgttctgctaaaattcaa
actcaagaaaagcatgagttttttattactcaaatcatcaaagaagattctaataaattt
tatggcttcttggataaagatgaacaaaaaatgtttgaaatgcttttaaaagtcaatgga
gtgggtgcaaatactgctatggcggtatgctctagtcttgatgtaaattctttttacaaa
gcgttaagtttaggcgatgaaagcgtgcttaaaaaagtacctggtataggtccaaaaagt
gcgaaacgcattatagtagaactttcagatacaaaaaccaaacttgaaaatgtaagcgat
gataaaagtgaagccttagccgcacttcttactctaggctttaaacaagaaaaaatcata
agtgttttagcaagtgctcaagcaacaggcacaagcgaactcatcaaagaagctcttaaa
aaactaggataa

DBGET integrated database retrieval system