KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0820Help
Entry
CJJ81176_0820     CDS       T00461                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
cjj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CJJ81176_0820 (ruvA)
Enzymes [BR:cjj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CJJ81176_0820 (ruvA)
DNA repair and recombination proteins [BR:cjj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CJJ81176_0820 (ruvA)
    RecFOR pathway proteins
     CJJ81176_0820 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N RuvA_C HHH Ribosomal_S13 5_3_exonuc HHH_3 Transposase_20 IMS_HHH HHH_8
Motif
Other DBs
NCBI-ProteinID: EAQ72443
UniProt: A1VZE7
Position
complement(749426..749977)
Genome map
AA seq 183 aa AA seqDB search
MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKF
YGFLDKDEQKMFEMLLKVNGVGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKS
AKRIIVELSDTKTKLENVSDDKSEALAALLTLGFKQEKIISVLASAQATGTSELIKEALK
KLG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggcatcgaaggaataatcacaaaaaaagaacctacttttatcattgttaaa
tgtgctagtggtttaagctatgggatatttatttcgcttttttgttctgctaaaattcaa
actcaagaaaagcatgagttttttattactcaaatcatcaaagaagattctaataaattt
tatggcttcttggataaagatgaacaaaaaatgtttgaaatgcttttaaaagtcaatgga
gtgggtgcaaatactgctatggcggtatgctctagtcttgatgtaaattctttttacaaa
gcgttaagtttaggcgatgaaagcgtgcttaaaaaagtacctggtataggtccaaaaagt
gcgaaacgcattatagtagaactttcagatacaaaaaccaaacttgaaaatgtaagcgat
gataaaagtgaagccttagccgcacttcttactctaggctttaaacaagaaaaaatcata
agtgttttagcaagtgctcaagcaacaggcacaagcgaactcatcaaagaagctcttaaa
aaactaggataa

DBGET integrated database retrieval system