KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1116Help
Entry
CJJ81176_1116     CDS       T00461                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cjj00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cjj00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1034771..1035658
Genome map
AA seq 295 aa AA seqDB search
MRHLITAKDFNKVEIMELFKEASDFLDEKPRTFLKGKSITTIFFENSTRTLSSFESAARR
LGARVLRLDVSRSSSSKGETLYDTAANLDAMSPNAIVVRHANSGVPLILAKHMHCPVVNG
GDGKHAHPTQALLDLFTIYNHFQGDVEGKKICIVGDIKNSRVAASNIELLSRFNLDITLV
APPHFMPNTHLKKHYKLDENIIANSDIIMSLRTQTERHNKTVYASLKDYANDFCIQKSLV
KDKKLILLHPGPVNRNIDISDEMMSDERTLVLKQVKNGVAIRMAVLKKLILENEG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcactgcaaaggattttaataaagtcgaaattatggagctttttaaa
gaagcaagtgatttcttagatgaaaaacctagaacttttcttaaaggaaaaagtatcacg
acaattttttttgaaaactctacacgcaccctttcatcttttgaaagcgctgcaagaaga
ttaggtgctagggttttacgccttgatgtttcaagatcaagctctagcaaaggagaaact
ctttatgatactgctgctaatttagatgccatgagtcctaatgctattgttgtaagacac
gcaaactcaggagttcctttgatattagcaaagcatatgcattgtccagttgttaatgga
ggagatggaaaacacgcccatcctacccaagctttgctagatttatttactatttataat
cattttcaaggtgatgtcgaaggtaaaaaaatttgcatcgtaggtgatattaaaaactct
cgtgtagcagcgtctaatatagaacttttaagcagatttaatcttgatattaccctagta
gctccaccgcattttatgcctaatacccatcttaaaaaacattataagcttgatgagaat
atcatagcaaattcagatattatcatgagtcttagaacacaaacagaaagacataataaa
accgtttacgcttcacttaaagactatgcaaatgatttttgtattcaaaaaagcttagta
aaagataaaaagcttattttactacatccaggccctgtaaatcgcaatattgacataagc
gatgaaatgatgagcgatgaaagaactttagttttaaaacaagttaaaaatggagtggcc
attagaatggctgttcttaaaaaactcatattagaaaatgaaggataa

DBGET integrated database retrieval system