KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1279Help
Entry
CJJ81176_1279     CDS       T00461                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CJJ81176_1279 (recR)
DNA repair and recombination proteins [BR:cjj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CJJ81176_1279 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1195350..1195922
Genome map
AA seq 190 aa AA seqDB search
MVKGLEKFNELVESFANLPTIGKKTAIRLAYHLCINNQIDGMKLAHNIENAIRFIKPCEQ
CGALSENELCEICSDEERNKNILCIVESPKDILTLEESQSYNGLYFVLDELNEEKLEKLK
QIILKLNISELIFALTHSINSDATIFFIEDKFKGLNLTFSKIAQGIPSGVNLENVDLISL
NKAMNFRTKI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaggcctggaaaaattcaatgaacttgttgaaagttttgcaaatttacctacc
ataggaaaaaaaaccgccataaggcttgcttatcacctttgcataaataatcaaatcgat
ggtatgaaactcgcacacaatatagaaaatgctatccgctttataaaaccttgtgagcaa
tgcggtgctttaagcgaaaatgagctttgcgaaatttgtagcgatgaagaaagaaataaa
aacattttatgtatagttgaaagcccaaaagatatactaacactcgaagagagtcaaagt
tacaatgggctatattttgttttagatgagttaaatgaagaaaaacttgaaaaactaaag
caaatcatacttaagctaaatatctctgagctcatttttgcattgacacatagcattaat
tctgatgcaactatcttttttatagaggataaatttaaaggcttaaacctaacttttagt
aaaatcgctcaaggaattccaagtggtgtaaatttagaaaatgtggatttaatctcttta
aataaagctatgaattttagaacaaaaatttag

DBGET integrated database retrieval system