KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1350Help
Entry
CJJ81176_1350     CDS       T00461                                 

Gene name
pldA
Definition
phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cjj00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:cjj00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cjj00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:cjj00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1267099..1268088
Genome map
AA seq 329 aa AA seqDB search
MRKIALFLNLCVFIWASDLQQALEYEKQGDYKKAMEIYKKLALKNSSVLISQEQNNSSQT
TQTQNSITIKKEEKQDFSRLALANYLGENESFNPLGISSYKMNYFLPFAYSFNSLGTNNN
KSEAKFQLSVKKRLFENLLGLDEKYYIAYTQTSWWQIYEHSSPFRETNYQPEFFIDFPLY
LKDYEFFNNLRVGILHESNGKGDENLQSRSWNRIYVSTAILYNKFLFVPRLWYRIPESKK
DDDNPAILHYMGNFDVNLAYLGDDYFINLMLRNNLKFHDNKGAIQVDLGYDIFNNGIYWY
LQYFNGYGESLIDYNKHLQRLSTGFLISY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgctttatttttaaacttatgcgtttttatatgggctagtgatttacag
caagctttagagtatgaaaaacaaggcgattataaaaaagctatggaaatttacaaaaaa
ctcgctttaaaaaattcatctgttttgatttctcaagaacaaaacaactcaagccaaaca
acacaaacgcaaaattctatcactataaaaaaagaagaaaaacaagacttttctcgctta
gctttggctaattatcttggtgaaaatgaaagctttaatccccttggcattagctcttat
aagatgaattattttttaccttttgcttatagttttaattctttaggaacaaataataat
aagagtgaggcgaaatttcaacttagtgttaaaaaaagactttttgaaaatttactagga
ctagatgaaaaatattatatagcctatactcaaacttcttggtggcaaatttatgagcat
tcttctccttttagagaaaccaactatcaaccagaattttttatagattttcctttgtat
cttaaagattatgaattttttaacaatctacgcgtaggtatattgcatgaaagcaatggc
aagggagatgagaatttacaatctcgctcatggaatagaatttatgtatctacggctatt
ttatataataaatttttatttgttccacgcctttggtatagaattcctgaaagcaaaaaa
gatgatgataatcctgctatcttgcattatatgggaaattttgatgtgaatttagcgtat
ttgggcgatgattattttatcaatctcatgctaagaaacaatcttaaattccacgataac
aaaggtgctatacaagttgatctaggatatgatatttttaataacggaatttattggtat
ttacaatactttaatggctatggagaaagccttatagactataacaaacacttgcaaaga
ctttccactggatttttgatttcttactaa

DBGET integrated database retrieval system