KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1350Help
Entry
CJJ81176_1350     CDS       T00461                                 

Gene name
pldA
Definition
(GenBank) phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
cjj00564  Glycerophospholipid metabolism
cjj00565  Ether lipid metabolism
cjj00592  alpha-Linolenic acid metabolism
cjj01100  Metabolic pathways
cjj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJJ81176_1350 (pldA)
   00565 Ether lipid metabolism
    CJJ81176_1350 (pldA)
   00590 Arachidonic acid metabolism
    CJJ81176_1350 (pldA)
   00591 Linoleic acid metabolism
    CJJ81176_1350 (pldA)
   00592 alpha-Linolenic acid metabolism
    CJJ81176_1350 (pldA)
Enzymes [BR:cjj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CJJ81176_1350 (pldA)
    3.1.1.32  phospholipase A1
     CJJ81176_1350 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 Aida_N TPR_7 MIT TPR_2 TPR_6 TPR_8 DUF627 TPR_1
Motif
Other DBs
NCBI-ProteinID: EAQ72792
UniProt: A0A0H3PBB2
Position
1267099..1268088
Genome map
AA seq 329 aa AA seqDB search
MRKIALFLNLCVFIWASDLQQALEYEKQGDYKKAMEIYKKLALKNSSVLISQEQNNSSQT
TQTQNSITIKKEEKQDFSRLALANYLGENESFNPLGISSYKMNYFLPFAYSFNSLGTNNN
KSEAKFQLSVKKRLFENLLGLDEKYYIAYTQTSWWQIYEHSSPFRETNYQPEFFIDFPLY
LKDYEFFNNLRVGILHESNGKGDENLQSRSWNRIYVSTAILYNKFLFVPRLWYRIPESKK
DDDNPAILHYMGNFDVNLAYLGDDYFINLMLRNNLKFHDNKGAIQVDLGYDIFNNGIYWY
LQYFNGYGESLIDYNKHLQRLSTGFLISY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgctttatttttaaacttatgcgtttttatatgggctagtgatttacag
caagctttagagtatgaaaaacaaggcgattataaaaaagctatggaaatttacaaaaaa
ctcgctttaaaaaattcatctgttttgatttctcaagaacaaaacaactcaagccaaaca
acacaaacgcaaaattctatcactataaaaaaagaagaaaaacaagacttttctcgctta
gctttggctaattatcttggtgaaaatgaaagctttaatccccttggcattagctcttat
aagatgaattattttttaccttttgcttatagttttaattctttaggaacaaataataat
aagagtgaggcgaaatttcaacttagtgttaaaaaaagactttttgaaaatttactagga
ctagatgaaaaatattatatagcctatactcaaacttcttggtggcaaatttatgagcat
tcttctccttttagagaaaccaactatcaaccagaattttttatagattttcctttgtat
cttaaagattatgaattttttaacaatctacgcgtaggtatattgcatgaaagcaatggc
aagggagatgagaatttacaatctcgctcatggaatagaatttatgtatctacggctatt
ttatataataaatttttatttgttccacgcctttggtatagaattcctgaaagcaaaaaa
gatgatgataatcctgctatcttgcattatatgggaaattttgatgtgaatttagcgtat
ttgggcgatgattattttatcaatctcatgctaagaaacaatcttaaattccacgataac
aaaggtgctatacaagttgatctaggatatgatatttttaataacggaatttattggtat
ttacaatactttaatggctatggagaaagccttatagactataacaaacacttgcaaaga
ctttccactggatttttgatttcttactaa

DBGET integrated database retrieval system