KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1382Help
Entry
CJJ81176_1382     CDS       T00461                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Brite
Enzymes [BR:cjj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CJJ81176_1382
Secretion system [BR:cjj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CJJ81176_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1307206..1307916
Genome map
AA seq 236 aa AA seqDB search
MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVE
LNGQKQENILFTKDSLITPDLIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMV
IALGDKNKPAIYVFSDPECPYCREHLAQIDDELKNYQVNYILTPVHGKSAFEKSALIYKE
AKKAKNDKEKIAILNKYYDANIKNYPKVSDAELKEVFSLYEKYRSLGLSATPTIIK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaagtttaattcttgcctgttcagcatctttgtttgctgcaagtaattca
gaaattagtgatttttattcaaaaagcattaaagcacaatttccaaatgctaccgttagt
gtatcaaatcgtcaaaaggttggtaatacgggttttgaaagtgttattgtaagcgttgaa
ttaaatggacaaaaacaagaaaacattctttttacaaaagatagtcttattacccctgat
cttatcgacttgaaaacgggaatttcttatgctcaagaatatgaaatgaaaaaatttcaa
gaagcaagagaaaattttacaaaaaatgctaaagctgtagcacaaaaagaaaccatggta
atagctttgggagataaaaataaacctgcaatttatgttttttcggatcctgaatgccct
tattgtagagaacatttagctcaaattgatgatgaacttaaaaactatcaagttaattat
attttaactccagtacatggaaaatctgcttttgaaaaatccgctctaatctacaaagaa
gcaaaaaaagcaaaaaatgataaagaaaaaatcgcaattttaaacaaatactatgatgca
aatatcaaaaattatccaaaagtaagtgatgcagaattaaaagaagttttttccttatat
gaaaaatatcgctcattaggtcttagcgctactccaactattattaaataa

DBGET integrated database retrieval system