KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1400Help
Entry
CJJ81176_1400     CDS       T00461                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
cjj00010  Glycolysis / Gluconeogenesis
cjj00051  Fructose and mannose metabolism
cjj00562  Inositol phosphate metabolism
cjj01100  Metabolic pathways
cjj01110  Biosynthesis of secondary metabolites
cjj01120  Microbial metabolism in diverse environments
cjj01130  Biosynthesis of antibiotics
cjj01200  Carbon metabolism
cjj01230  Biosynthesis of amino acids
Module
cjj_M00002  Glycolysis, core module involving three-carbon compounds
cjj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJJ81176_1400 (tpiA)
   00051 Fructose and mannose metabolism
    CJJ81176_1400 (tpiA)
   00562 Inositol phosphate metabolism
    CJJ81176_1400 (tpiA)
Enzymes [BR:cjj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CJJ81176_1400 (tpiA)
Exosome [BR:cjj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CJJ81176_1400 (tpiA)
  Exosomal proteins of bladder cancer cells
   CJJ81176_1400 (tpiA)
  Exosomal proteins of melanoma cells
   CJJ81176_1400 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: EAQ72652
UniProt: A0A0H3PAG6
Position
complement(1323120..1323791)
Genome map
AA seq 223 aa AA seqDB search
MIFAANLKCNHTRASFKIYAEILNKTIGVKCDDIIVFPPSVAFLEKENNFIQGAQNFYPC
VNGAFTGELGKEHLDEFGIKCVLIGHSERRALGDEEFIKAKFDFAKEHGYKIVFCIGENL
DTKNSGKTLEFLKKQLEIIDLNYEKLIIAYEPIYSIGTGVSAQSTDIAKVLEFLASLTKA
PLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgctgcaaatttaaaatgcaatcacacaagagcaagttttaaaatttatgct
gaaattttaaataaaactataggggtaaaatgcgatgatattatcgttttcccacctagt
gtagcatttttagaaaaagaaaataacttcatacaaggagcccaaaatttttatccttgt
gttaatggtgcttttacaggcgagcttggaaaagaacatttggacgaatttgggatcaaa
tgcgttttaatcgggcattctgaaagaagagctttaggagatgaagaatttattaaggct
aaatttgattttgctaaagagcatggttataaaattgttttttgtataggtgaaaattta
gatacaaaaaattcaggcaagactttagagtttttaaaaaaacaacttgaaattattgat
ttaaattatgaaaaactcattatcgcttatgagcctatttattctataggaacgggagtg
agtgcacaaagtacagatatcgctaaagtgcttgaatttttagcgagtttaaccaaggca
cctttgctttatggtggaagtgtgaatgaaaataatatcaaagaaattttaagtgtaaat
cattgtggtggagttttgataggctctgcagctttaaaagtagaaaattttataaaatta
atcaaaggataa

DBGET integrated database retrieval system