KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1406Help
Entry
CJJ81176_1406     CDS       T00461                                 

Gene name
algC
Definition
phosphomannomutase/phosphoglucomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJJ81176_1406 (algC)
   00030 Pentose phosphate pathway
    CJJ81176_1406 (algC)
   00051 Fructose and mannose metabolism
    CJJ81176_1406 (algC)
   00052 Galactose metabolism
    CJJ81176_1406 (algC)
   00500 Starch and sucrose metabolism
    CJJ81176_1406 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CJJ81176_1406 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CJJ81176_1406 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CJJ81176_1406 (algC)
Enzymes [BR:cjj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CJJ81176_1406 (algC)
    5.4.2.8  phosphomannomutase
     CJJ81176_1406 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1327407..1328777)
Genome map
AA seq 456 aa AA seqDB search
MLDVIFREYDIRGLYGKELNEKSVKAIGFCLGQTMLNKGCKNVSVGYDARYSANELFNYL
VSGLNKAGIKIYDIGLVPTPLGYFSLYEGLKFDANVMITGSHNPKDYNGFKITINKESFF
GVELKEFSKEVYKYLDDDIEENLEVEKYDILNLYVKFMCEQFSFLKDFNYKFGVDCTNGA
AGVVIEPLIKALNLKAHVMFAEPDGQFPNHAPDPTEEENLSAIREFLNQNQDYSLAFAFD
GDADRMVALSKTHVFCGDELCYLFAKDIPNPRILGEVKCSKNLFDEVAKFGTIFMGKTGH
SNIKKMMKEKDIDLAAEVSGHIFFKHRYFGYDDGIYAFLRALELVYKGFDLESMIKALPK
LYTTPEIKIPVNEEEKFKLVEEFQKEIEKGALKGVKSLCEIDGARIDFGDGWALLRASNT
SPYLITRFEATSLERAKELESMVFTLFNDIKARFKN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtgatttttagagaatatgatataagaggactttatggcaaagaactgaat
gaaaaaagtgttaaggctataggtttttgcttaggacaaaccatgctaaataaaggctgt
aaaaatgtaagtgtgggttatgatgcaagatatagtgcaaatgagctttttaattatctg
gtgagtggacttaacaaagcgggaataaaaatctatgatatagggcttgtgccaactcca
ttggggtattttagtctttatgagggcttgaaatttgatgcaaatgttatgataacaggc
tctcataacccaaaagattataatggttttaaaatcactatcaataaagaaagttttttt
ggcgtagagttaaaagagttttcaaaagaagtttataagtatttagatgatgatattgaa
gaaaatttagaagtagaaaaatacgatattttaaacctttatgtgaaatttatgtgcgag
caatttagctttttaaaggattttaattataaatttggtgttgattgcacaaatggtgcg
gctggagtagtgatagagcctttaattaaagctttaaatttaaaagctcatgtaatgttt
gcagagcctgatggacagtttccaaaccatgctccagatcctacagaagaagaaaactta
agtgcgattagagaatttttaaatcaaaatcaagattattctttagcttttgcttttgat
ggggatgctgatagaatggttgctttgagtaaaactcatgtattttgtggggatgagctt
tgttatttgtttgctaaagatatccctaatccacgcattttaggtgaggtaaaatgttct
aaaaatctttttgatgaagtggctaaatttggaactatttttatgggaaaaacaggacat
tctaatatcaaaaaaatgatgaaagaaaaagatattgatttagctgctgaagtgagtggg
catattttctttaaacatagatattttggttatgatgatggaatttatgcatttttaaga
gccttggagcttgtttataaaggttttgatctagaaagtatgattaaagctttaccaaaa
ctttatactacacctgaaattaaaattcctgtaaatgaagaagaaaaattcaaacttgtg
gaagaatttcaaaaagagattgaaaaaggagctttaaaaggtgttaaaagtctttgtgaa
attgatggagctaggatagattttggcgatggatgggctttacttcgtgcatctaatacc
agcccttatcttatcacacgctttgaggcaacatctttagaaagagcaaaagagcttgaa
agtatggtatttactttgtttaatgatataaaagctagatttaagaattga

DBGET integrated database retrieval system