KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1430Help
Entry
CJJ81176_1430     CDS       T00461                                 

Definition
putative nucleotide-sugar epimerase-dehydratase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CJJ81176_1430
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CJJ81176_1430
Enzymes [BR:cjj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CJJ81176_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1349988..1350533)
Genome map
AA seq 181 aa AA seqDB search
MAIEFNIQESKILKGVYIITPNKFRDLRGEIWTAFTSKAVDKLLPNGLKFIHDKFIHSKH
NVIRGIHGDVKTYKLATCVYGEIHQVVVDCRKDSPTYLKYEKFIINQDNQQIILVPAGFG
NAHYVTSESAVYYYKCAYKGDYVDAPDQFTYAWNDERIGIDWPTNSPILSERDILATKNK
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagaatttaatatacaagaatcaaaaattttaaagggagtgtatatcataact
cctaataaatttagagatttaagaggtgaaatttggacagcttttacaagcaaggctgta
gataagcttttaccaaatggattaaaatttatacacgataaatttatacactcaaaacac
aatgttattcgcggtatccatggcgatgtaaaaacttataagcttgcaacttgtgtttat
ggggaaattcatcaggtggtggtagattgcagaaaagattcgccaacctatttaaagtat
gaaaaattcatcataaatcaagataatcagcaaatcatcttagtgccagcaggttttgga
aatgctcattatgttactagtgaaagtgcagtttattactataaatgtgcttataaagga
gattatgtggatgcgcctgatcaatttacttatgcatggaatgatgaaagaatcggtata
gattggccaacaaattctcctattctttcagaacgtgatattttagcaactaaaaataaa
ggataa

DBGET integrated database retrieval system