KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1632Help
Entry
CJJ81176_1632     CDS       T00461                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cjj00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cjj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1542198..1543481
Genome map
AA seq 427 aa AA seqDB search
MKLKLENSFITDSTLECEKECFFLQTTQNAKFHARALEKGAKIIDVNECKKLLKIDEKIQ
IIGITGTNGKTTTAAAIYSILLDLGYKCGLCGTRGAFINDEQIDEKSLTTSPILKTLEYL
QIATQKKCDFFIMEVSSHALVQNRIEGLNFVAKIFTNITQDHLDFHGTFENYKKAKELFF
TDESLKFINKDALAIKFNVRNAFTYGIENPALYQIKAYSLEEGISAIVTNKNQTFHIDSP
LLGLFNLYNLLVASACVNELIKPDLKDLEKAISGFGGVCGRVEQVAKGVIVDFAHTPDGI
EKVLDTLKNKQLIVVFGAGGDRDKTKRPLMGKIVEHFAKIAIITSDNPRSEEPKTIMEEI
LSGFAKKEKVLMIEDRKEAIKKALELKENDDLVVILGKGDETTQEIKGIKYPFSDKVVVN
EILKNQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaaaacttgaaaattcattcattacagatagtaccttagagtgtgaaaaagaa
tgcttttttttacaaaccacacaaaatgctaaatttcacgctcgagccttagaaaaaggt
gcaaaaatcattgatgtaaatgagtgtaaaaaacttttaaaaatcgatgaaaagattcaa
atcataggaatcacaggaaccaatggcaaaaccacaaccgcagcagcgatttactctatc
ttattggatttaggttataaatgcgggctttgcgggacaagaggagcttttatcaacgat
gaacaaattgatgaaaaatccttaaccacctcccctattcttaaaaccttagagtaccta
caaatagctactcaaaaaaaatgtgattttttcatcatggaagtaagctcacacgcactc
gttcaaaaccgtatcgaaggcttaaattttgttgctaaaatttttaccaatatcactcaa
gatcatttagattttcacggtacttttgaaaattacaaaaaagcaaaagaactttttttt
acagatgagagtttaaaatttatcaacaaagatgctttggctattaaatttaatgtgcgt
aatgcttttacttatggcatagaaaatcctgccttatatcaaatcaaagcttattcttta
gaagaaggcattagtgctattgtaacaaataaaaatcaaacttttcacatagactccccc
ttactaggactttttaatctttataatcttttagttgctagtgcttgtgtgaatgaactc
ataaagcctgatttaaaagacttggaaaaagctatcagtggatttggcggagtttgtggt
agagtagaacaagtagcaaaaggtgtgattgtggattttgctcatacgcctgatggcatt
gaaaaagtacttgacactcttaaaaataaacaactcatcgttgtttttggagcaggtgga
gatagagataaaaccaaacgccctttaatgggaaaaatcgtcgaacattttgcaaaaatt
gctatcattacaagtgataatccacgtagcgaagaaccaaaaaccatcatggaagaaatt
ttatcaggctttgctaaaaaagaaaaagttttaatgatagaagatagaaaagaagctata
aaaaaagctttagaactaaaagaaaatgacgatttggtcgttattttaggcaaaggtgat
gaaactactcaagaaattaaagggataaaatatccttttagtgataaagtagttgttaat
gaaattttaaaaaatcaaggataa

DBGET integrated database retrieval system