KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1678Help
Entry
CJJ81176_1678     CDS       T00461                                 

Gene name
topA
Definition
DNA topoisomerase I (EC:5.99.1.2)
Orthology
K03168  
DNA topoisomerase I [EC:5.99.1.2]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Brite
Enzymes [BR:cjj01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.2  DNA topoisomerase
     CJJ81176_1678 (topA)
DNA repair and recombination proteins [BR:cjj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      CJJ81176_1678 (topA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1578474..1580576)
Genome map
AA seq 700 aa AA seqDB search
MKKNLIIVESPAKAKTIGNFLGKDYEVIASKGHIRDLPKSSFGIKIEDDEFIPEYRITSD
HSALVKELKSKAKDAKEVYLATDEDREGEAIAYHIAKAIGKDENTLPRIVFHEITKNAIE
NALKNPRKLDMHSVNAQQTRRLLDRIVGYKLSPLLGQKIQRGLSAGRVQSAALKIIVDRE
KEIRAFVPLEYFSIDMIFQKDLDAELVEFDKAKIEKLTIANKDRAKLILEACKNEAYTIS
DIESKERKIAPPPPFMTSTLQQSASNRLGFNPKKTMMIAQKLYEGVNTHEGVMGVITYMR
TDSLNLAKEAIENARKFIQANFGKDYLPSKANVYTTKAKGAQEAHEAIRPTNLSFTPEIA
AKFLDKDELKLYTLIYNRFLACQMNPAISQTQNVFVKNDRAVFKISGRKILFDGYYKVYG
DMDKDKILPNFKIGENLKIQNLEMNSHFTEPPSRYSEAGLVKKLESLGIGRPSTYAPTIS
ILTSRDYVKIDKKQLIPSDVAFNVTEVLEKNFSDIVDSKFTSNLENTLDEIAEDKADWQE
TLKEFYYPFMRKIEEGKTKIASQKTVTKLGESCPDCGGELAIRKGRFGEFVACLNFPKCK
YSRNLKSESKNESENTAAKAKANGTGITCPSCQKGEIVERFSKRGKFYGCSAYPKCNFIS
KYKPSEEKCEECGETLVIKELKKGIFLECLKCKIKKEMKD
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaatttaatcatagtagaatctcctgcaaaagctaaaaccataggaaatttt
ttgggaaaagattatgaagttatcgcttccaaaggacatattagagatttgcctaaatca
agctttgggattaaaatagaagatgatgaatttatccctgagtatagaatcacaagtgat
catagcgccttagttaaagaacttaaaagcaaagccaaagatgccaaagaagtctatctt
gcaacggatgaggatagagaaggagaggctatagcctatcatattgcaaaagctatagga
aaagatgaaaacaccttaccacgtattgtttttcatgaaatcactaaaaacgctatagaa
aatgctttaaaaaatccaagaaaattagatatgcactctgtaaatgctcagcaaactaga
cgccttttagatcgcattgtagggtataagctcagccctttattgggacaaaaaattcaa
agaggacttagtgctgggcgtgttcaaagtgcagctttaaagatcatagtcgatcgtgaa
aaagaaattcgtgcctttgtacccctagaatactttagcatagatatgatttttcaaaaa
gatttagatgcagaactagttgagtttgataaagccaagatagaaaaacttaccattgct
aacaaagatcgtgctaaactcatactagaggcttgtaaaaatgaagcttatactataagc
gacattgaaagtaaagaaagaaaaatcgctccaccgcctccttttatgacttcaaccttg
cagcaaagtgctagcaatcgccttggttttaaccctaaaaaaaccatgatgatagctcaa
aaactctatgagggagtaaatacccatgaaggcgtgatgggggttattacctacatgaga
accgatagtttaaatttggccaaagaagctatagagaatgcaagaaaattcatacaagca
aattttggcaaagactatcttccaagtaaagcaaatgtatacactacaaaagccaaaggt
gctcaagaagctcatgaagctatacgtcctacaaatttaagttttactccagaaattgcg
gccaaatttttagacaaagatgagttaaaactttacacacttatttacaatcgcttttta
gcctgtcagatgaatcctgctatctctcaaactcaaaatgtatttgtaaaaaatgataga
gcagtttttaaaataagcggtagaaaaatcctttttgatggatattataaagtttatggt
gatatggataaggataaaattttaccaaattttaaaataggtgaaaatttaaaaatacaa
aatttagaaatgaactcacattttaccgaaccaccttcaaggtattcagaagcaggactt
gtaaaaaaacttgaaagtttaggcataggtcgcccttctacctatgcgccaaccatttct
atacttacaagccgtgattatgtaaaaatagataaaaaacaactcattcctagcgatgtt
gcttttaatgtaaccgaagtgcttgaaaaaaattttagcgatatagtagatagtaaattt
acttcaaaccttgaaaataccttagatgaaatcgcagaagataaggcagattggcaagaa
actttaaaagaattttactatccttttatgagaaaaatcgaagaaggaaaaacaaaaata
gctagtcaaaaaactgtcacaaagctaggcgaaagttgtcctgattgtggcggggagctt
gctattagaaaagggcgttttggagaatttgtagcgtgtttaaatttcccaaaatgtaag
tattcaagaaatttaaaaagtgaaagtaaaaatgaaagcgaaaatactgctgcaaaagct
aaagctaatggtacaggtattacttgtccaagttgtcaaaaaggtgaaatcgtagaacgc
ttttcaaaacgcggtaaattttatggttgtagtgcttatccaaaatgcaattttataagc
aaatacaaaccaagtgaagaaaaatgcgaagagtgtggcgaaactttagtgataaaagag
cttaaaaaaggtatattcttagaatgcttaaagtgcaaaatcaaaaaagaaatgaaggat
tag

DBGET integrated database retrieval system