KEGG   Corynebacterium jeikeium: jk0107Help
Entry
jk0107            CDS       T00255                                 

Gene name
phoD
Definition
hypothetical protein (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cjk  Corynebacterium jeikeium
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    jk0107 (phoD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    jk0107 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    jk0107 (phoD)
Enzymes [BR:cjk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     jk0107 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(126153..127925)
Genome map
AA seq 590 aa AA seqDB search
MTKKPQDNSTPAQSGQFTRRQVLQTSAAGAAAVGIGAVAANSTASAAPLGSAKPANPPIN
KKMGKQAFQHGVASGDPYPDSVLLWTRVTSNENDYPGDGRGQATTVKWEVASDEKFTQIV
TSGTAKAEPSSDMTVKVEARGLKPYTGYFYRFITVDGPRKDQTSPVGKTRTAPAKGADVS
ELRFALFSCSNWEAGFFSAYRDMAKRGDIDYALHVGDYIYEYPRGEYTGKTGSVRLHEPA
NEIVSLADYRQRYALHHTDPDLQAAHAACPWIVTWDDHEVANDNWSHGAENHQADKEGDF
IARRDAAMQAYLEWLPIRATPVSKQGHIYRNLSFGNLVELNMLDLRTYRNEKPGFTSARK
TDDESRTMLGSEQFGWLTKKLSTSTARWNLIGNSVMFSPVLIPPLDPEATKAVTQLLGLP
EEGMPYNFDQWDGYAAERRRVIKYLVDNKIRNTVWLTGDIHSSWANDIPAKPGTYPNGGT
AGVEIVCTSVTSSNIDDILKLPEDNALSHTVEYAFTNMNRHVKYLDFDSHGYTVVRVTKD
AVDANWIFLGPDGKLQPNQPLHFGKAATAKWGEGIHTSTERIDPAKHSAR
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaagcctcaggataattccaccccggcccagtccggccagttcacccgccgc
caggttctacagaccagcgccgctggtgcagctgccgtcggcatcggtgccgttgccgcc
aactccactgcctctgccgcgccgctggggtccgccaagcccgcgaacccgcccatcaac
aagaagatgggcaagcaggccttccagcacggcgttgcttccggcgacccatacccggat
agcgtcctgctgtggactcgcgtgacctctaacgaaaacgactacccgggcgatggccga
ggccaggccaccactgtgaagtgggaggtcgccagcgacgaaaagttcacccagatcgtc
acttccggcaccgccaaggcagagccatccagcgacatgaccgtgaaggtagaagcccgt
ggcctaaagccctacaccggctacttctaccgcttcatcactgtcgacggccctcgcaag
gaccagacttccccggtaggcaagacccgtaccgcaccagccaagggcgccgatgtttcc
gaactgcgcttcgcgctgtttagctgctctaactgggaagccggtttcttcagcgcctac
cgcgatatggccaagcgcggcgacatcgactacgcgctgcacgtcggcgactacatctac
gagtacccgcgcggtgagtacaccggtaagaccggctctgtccgcctgcacgagccggcc
aacgagatcgtctccctggccgactaccgccagcgctacgccctgcaccacaccgacccg
gacctgcaggccgcgcatgctgcttgcccatggatcgttacctgggatgaccatgaggtc
gccaacgataactggtcgcacggcgcggagaaccaccaggcagacaaggagggcgacttc
atcgcccgccgcgacgccgccatgcaggcatacctggagtggctgccaatccgcgccacc
ccggtttccaagcagggccacatctaccgcaacctgtccttcggtaacctggtcgagctg
aacatgctggatctgcgcacctaccgcaacgaaaagcccggcttcacttccgcccgcaag
accgacgatgagtcccgcaccatgctgggctctgagcagttcggttggctgaccaagaag
ctgtccacctccacggcccgatggaacctcatcggcaactctgtgatgttcagcccggtc
ctaattccgccgctggacccggaggccaccaaggccgtcacccagcttctgggactgccg
gaagaaggcatgccctacaacttcgaccagtgggatggctacgccgccgagcgtcgccgt
gtaatcaagtatttggtggacaacaagatccgcaacactgtctggctcaccggcgacatc
cactcctcctgggccaatgacattccggccaagccgggaacctacccgaacggcggcact
gccggcgtggagatcgtctgcacctccgttacctcctccaacatcgacgacattctgaag
ctgccggaggataacgcgttgtctcacaccgtggagtacgccttcaccaacatgaaccgc
cacgtgaagtacctggatttcgactcccacggctacaccgtcgtgcgtgtcacgaaggat
gccgtggacgccaactggatcttcctcggcccagacggcaagctgcagccaaaccagcca
ctgcacttcggcaaggccgctaccgcgaagtggggcgagggcatccacacctcaaccgag
cgcatcgaccctgctaagcactccgctcgctaa

DBGET integrated database retrieval system