KEGG   Corynebacterium jeikeium: jk0159Help
Entry
jk0159            CDS       T00255                                 

Gene name
fadB1
Definition
(GenBank) fadB1
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00071  Fatty acid degradation
cjk00280  Valine, leucine and isoleucine degradation
cjk00281  Geraniol degradation
cjk00310  Lysine degradation
cjk00362  Benzoate degradation
cjk00380  Tryptophan metabolism
cjk00410  beta-Alanine metabolism
cjk00640  Propanoate metabolism
cjk00650  Butanoate metabolism
cjk00903  Limonene and pinene degradation
cjk00930  Caprolactam degradation
cjk01040  Biosynthesis of unsaturated fatty acids
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
cjk01120  Microbial metabolism in diverse environments
cjk01130  Biosynthesis of antibiotics
cjk01200  Carbon metabolism
cjk01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    jk0159 (fadB1)
   00650 Butanoate metabolism
    jk0159 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    jk0159 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    jk0159 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    jk0159 (fadB1)
   00310 Lysine degradation
    jk0159 (fadB1)
   00380 Tryptophan metabolism
    jk0159 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    jk0159 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    jk0159 (fadB1)
   00281 Geraniol degradation
    jk0159 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    jk0159 (fadB1)
   00930 Caprolactam degradation
    jk0159 (fadB1)
Enzymes [BR:cjk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     jk0159 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     jk0159 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     jk0159 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 2-Hacid_dh_C Peptidase_S49 adh_short_C2 NAD_binding_8 UDPG_MGDP_dh_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CAI36311
UniProt: Q4JXZ6
Position
complement(196585..198912)
Genome map
AA seq 775 aa AA seqDB search
MSMFKWDQDGDGIVTITMDDPNQPVNTMNDTFQGELPELVEKLQGAVESGEAKGVVITSA
KKTFFAGGDIKSMIKSTPEDAEAITKQINGMKAGLRAIETLGVPVVAAINGAALGGGLEI
ALATHHRIASDAKGLKVGLPEVTLGLLPGGGGVTRVVRMLGIQDALMKVLTTGRQFRAED
ALKTGLIDEVAPADQLIDAAKKWIKENPEASQPWDQKGFKIPGGTPTNPQLAQFLPSFPA
NVTKQIKGAPMPAPKAILKAAVEGAQLKNIEEALAVETRYFVELVTGTTSKNMMQAFFFD
LQYCNGGGSRPKDVEKKQFKKLGMVGAGMMGAAIAYVAAKAGMEVVLKDIKMEAAEKGKS
YSEGLEAKALKRGKTTEEKSKALLDRIKPSVDYSDLSDCDIVIEAVFENTELKHKVWAEI
EAAVPEDCVLGSNTSTLPITELATGVKRPKDFIGIHFFSPVDKMPLVEIIKGEETSDETL
AAALDFTGQIRKTPIVVNDSRGFYTSRVIGFFLNEAMRMLAEGIDPAVIEAAGRQAGYPA
PPLQLQDELNLKLARKIGSETRAAQEAAGLTVDDGGVTEIVDKMLDVYDRPGKLEGKGFY
EYNEEGRRTGLWRGLWDELGAGKVKVADGESTVAGSGLDSAAAGAAQKAAADPSGVAAGS
NVPADAPAFIDLVERPLFAEALETQKCIDEGVLTSDADANIGSIMGIGFPAWTGGTRQYI
KNYDRPAAATLPEGKVADRDGGDYPTRGVAGFVARAEELAAKYGERFTPLESLKK
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgttcaagtgggaccaggatggcgacggcatcgtaaccatcaccatggacgac
ccgaaccagccggtcaacaccatgaacgacaccttccagggcgagctgcctgagctggtg
gagaagctgcagggcgcagtggagtccggcgaggccaagggcgtagtcatcacctctgcc
aagaagaccttcttcgccggcggcgacatcaagtcgatgatcaagtccaccccggaagac
gcagaagcaatcaccaagcagatcaacggcatgaaggccggcctgcgcgccatcgagacc
ctcggtgtgccggttgtcgccgccatcaacggtgcggcgctcggcggtggcctggagatc
gctctggccacgcaccaccgcattgcttctgacgccaagggcctgaaggttggcctgcca
gaggtcaccctgggtctgctgccgggtggcggcggtgtgacccgcgtggtccgcatgctg
ggcatccaggacgcactgatgaaggtcctgaccaccggccgccagttccgcgcagaagac
gcactgaagaccggcctgatcgacgaggtcgccccggcagaccagctgatcgacgctgcc
aagaagtggatcaaggagaacccggaagcatcccagccgtgggaccagaagggcttcaag
atcccgggcggcaccccgaccaacccgcagctggcacagttcctgccctccttcccggct
aacgtgaccaagcagatcaagggcgcaccgatgccggctccgaaggccatcctgaaggcc
gccgttgagggcgcacagctgaagaacatcgaagaggctctggccgtggagacccgctac
ttcgtggagctggtcaccggcacgacctccaagaacatgatgcaggcattcttcttcgac
ctgcagtactgcaacggtggcggctcccgcccgaaggacgttgagaagaagcagttcaag
aagctgggcatggttggtgccggcatgatgggcgcagcgatcgcttacgtggcagcgaag
gctggcatggaggtcgtgctgaaggacatcaagatggaggctgcggagaagggcaagtcc
tactccgagggtctggaggccaaggcactgaagcgcggcaagaccaccgaggagaagtcc
aaggccctgctggatcgcatcaagccttccgtcgactactccgacctgtccgactgtgac
atcgtgatcgaggccgtgttcgagaacaccgagctgaagcacaaggtctgggcagagatc
gaggcagccgtgccggaggattgcgtgctgggctccaacacctccaccctgccgatcacc
gagctggctaccggcgtgaagcgcccgaaggacttcatcggtatccacttcttctccccg
gtagacaagatgccgctggtggagatcatcaagggcgaggagacctccgacgagaccctg
gctgcggcactggacttcaccggccagatccgcaagaccccgatcgtcgtgaacgactcc
cgcggcttctacacctcccgcgtcatcggcttcttcctgaacgaggctatgcgcatgctg
gctgagggcatcgacccggccgtcatcgaggccgctggccgccaggctggctacccggca
ccgccgctgcagctgcaggacgagctgaacctgaagctggcccgcaagatcggttccgag
acccgcgccgcccaggaggccgctggcctgaccgtcgacgacggtggcgtgaccgagatc
gtagacaagatgctggacgtctacgaccgcccgggcaagctcgagggcaagggcttctac
gagtacaacgaggaaggccgtcgcaccggcctgtggcgcggcctgtgggacgagctgggt
gccggcaaggtgaaggtcgccgacggcgagtccaccgttgcaggctccggcctggactcc
gccgctgctggcgcagcccagaaggctgctgcggacccgagcggcgtggctgctggctcc
aacgttccggctgacgctccggccttcatcgacctggtggagcgcccgctgttcgccgag
gctctggagacccagaagtgcatcgacgagggcgtgctgacctctgatgcggatgccaac
atcggctccatcatgggcatcggcttcccggcatggaccggcggtacccgccagtacatc
aagaactacgaccgcccggccgccgctaccctgccggagggcaaggttgcggaccgcgac
ggtggcgactacccgacccgcggcgttgcaggcttcgttgcccgcgctgaggagctggcc
gctaagtacggcgagcgcttcaccccgctggagtccctgaagaagtag

DBGET integrated database retrieval system