KEGG   Corynebacterium jeikeium: jk0169Help
Entry
jk0169            CDS       T00255                                 

Definition
beta-glucosidase-related glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cjk  Corynebacterium jeikeium
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    jk0169
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    jk0169
Enzymes [BR:cjk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     jk0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211490..212695
Genome map
AA seq 401 aa AA seqDB search
MPRRHVAAGALGFALVVASSACSLSTPTDQPADTSASSATSAAPGSESSGAAESSTPPAE
NRPACARVEGKTPREMAGRMLAVGVTTYESAEQAVDEGVRHLFIGSQTDKSILNGQGDPA
RSLAALEKRAGEPLTVSVDEEGGLVQRLSEIIGELPSAKQMAETMSPEQVRDLMAEHGKK
VRDLGITVDFAPVVDLAGGQEVSDNAIGSRSFSADPKVAADYARAYSEGLQQAGVTPVLK
HFPGHGHATGDSHMGSVTTPPLEQMQANDLLPFRELIDVEGMAVMVGHVEVPGLGEPLPS
SVNPAAYKLLREGGYGPRHDAPGFDGVIYTDDLTGMKAVTDRYPGPEAAVAALAAGADVA
LAAAGAVEIPDVVEAIRVAIDDGRIPEDQVRDSVNRTCVTE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtagacacgttgccgctggcgctttaggtttcgctcttgttgttgcctctagc
gcttgttccttatcgacgcccactgaccagccagccgatacttccgcatcctcggccact
tccgctgcgcccggttccgaaagctccggtgccgccgaatccagcacacccccagcggag
aaccggccggcctgtgcccgggtggagggtaagacccctagggagatggctggccggatg
cttgctgtgggcgtcacaacctacgaatcagcagaacaagccgtcgacgaaggtgtgcgc
caccttttcattggctcgcagaccgacaagtccattttgaatggtcagggagaccctgcg
cgtagcctggcggcgctcgagaagcgcgcgggcgaaccgctgacggtgagcgtggacgag
gaaggcggtctggtgcagcgcctttccgagatcattggtgagctgccgagtgcgaagcag
atggcggagacgatgagccccgagcaggtgcgcgacctcatggccgagcacggtaagaag
gtccgcgacttgggaatcactgtggacttcgcgccggtggtggatctggctggtggtcag
gaggtttctgacaacgcgatcggctcacgttccttcagtgccgacccgaaggtggcggcg
gattacgcacgcgcctactcggagggcttgcagcaggcgggcgtgaccccggtgctgaag
cacttcccgggccacgggcacgccacgggcgactcgcacatgggatccgtgaccaccccg
ccgcttgagcaaatgcaagccaacgacctgctgcccttccgtgaacttatcgacgttgaa
ggcatggccgtgatggtcggccatgtggaggtgccggggttgggtgagcctttgccatcc
tcggtgaaccctgcggcctacaagctgttgcgggagggcggttatggcccgaggcatgac
gccccaggtttcgacggcgtgatttacaccgacgacctgacgggcatgaaggccgtgacg
gatcgctaccccggcccggaggcagccgtggcggcgctggcggctggggcggacgtggcg
cttgccgcagcgggggcagtggagatccccgatgtagtggaggccatccgcgtggcgatc
gacgacgggcggatccctgaggatcaggtgcgcgattctgtgaatcgtacctgtgtaacc
gagtaa

DBGET integrated database retrieval system