KEGG   Corynebacterium jeikeium: jk0280Help
Entry
jk0280            CDS       T00255                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cjk  Corynebacterium jeikeium
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344364..345269
Genome map
AA seq 301 aa AA seqDB search
MTGSAVTSTNANDPQRTLVMGILNVTEDSFSDGGAYPDTAAALAHAEAMVADGADIIDVG
GESTRPGATRVASEVAARVTPVIEELSRRGIATSIDTMRASTARAAWKAGVTYLNDVSGG
LADPDMLPLAAESGLPIILMHWNKGNAADFAGAEGYHDHGEDIVGHVIGWLEQRIEAAEA
VGVTKKQIYLDPGIGFAKSPQENWQLLGATERLVQMGYPVLVGASRKRFLTALRPASDGN
PGTPESADDATAATSALAAAVGAWAVRVHKVAPTRAAVDVAHAMATGRGPDIDEQWRARR
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggctctgctgtgactagcaccaacgcgaacgacccccagcgcaccctcgtgatg
ggcatcctcaacgtcaccgaggattccttctccgacggcggggcctacccggacaccgcg
gccgcgctggcacacgccgaggcgatggtcgctgacggtgcggacatcatcgacgtcggc
ggggaatccacccgcccgggcgccactcgcgttgcctcggaggtcgcggcccgcgtcacc
cccgtcatcgaggagctatcccgccggggaatcgccaccagcatcgacacgatgcgggca
tccacggcgcgggccgcctggaaagcgggcgtcacctacctcaacgacgtctccggcggc
ctggcggaccccgacatgctgccgctggccgcggaatccggcctgccgatcattctgatg
cactggaacaagggaaacgccgcggacttcgccggagctgagggctaccacgaccacggc
gaggacatcgtcggccacgtcatcggttggctcgagcagaggatcgaagcggcggaggcg
gtaggcgtcacaaagaaacagatctacctggaccccggcatcgggttcgcgaagagtccg
caggaaaactggcagctgctcggcgcgactgaacgactggtgcagatgggctatccggtg
ctggtgggggcctcgcgcaagcgcttcctcaccgcgctgcgccccgcgagcgacggcaac
cccggcaccccggaatcggcggacgatgcgacggcggccacctccgcgctggcggcggca
gttggcgcatgggccgtccgggtgcataaagtagccccgacacgggccgcagtggacgtc
gcacacgccatggccaccggacgcggccccgacatcgacgagcaatggagggcgcgacgt
ggctga

DBGET integrated database retrieval system