KEGG   Corynebacterium jeikeium: jk0282Help
Entry
jk0282            CDS       T00255                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cjk  Corynebacterium jeikeium
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
345624..346226
Genome map
AA seq 200 aa AA seqDB search
MITAFLGIGSNMPGDVGSPTAQIERAYELLAMHPAIEIVEKSRIFVTPPWGGVEQQEFRN
SVVAVRTSLDPLALLHHCQFAEAVAGREREVRWGPRTVDVDILFCFDAQSQPLQSQGKWG
FELVIPHPYAHERAFVLVPLSDLQLAREPWCTLGGRGILEWLEEVDPAERKAIVPADRSE
LSVPGEGQSLGTNTRTKDEG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagccttcctgggaattggctcgaacatgcccggcgacgtgggcagccccacc
gcacagatcgaacgcgcctacgagctgctggcgatgcacccggccatcgagatcgtggag
aagtcgcggatcttcgtcaccccgccgtggggtggggtggagcagcaggagttccgcaat
tccgtggtggccgtacgcacgtcgctggatccgctcgcgctgctgcaccactgccaattt
gccgaggccgtcgcggggcgggagcgcgaggtccggtggggcccgcgcaccgtcgatgtg
gacattcttttttgttttgacgcccagtcccagcccctgcagtcccagggaaagtggggg
tttgagctggttattccgcacccctacgcccacgagcgggcgtttgtgctggtgccgctg
agcgacctgcagctggcccgggaaccctggtgtaccttgggcgggcgaggcatcctggag
tggctagaagaggttgatccggccgagcggaaggctatcgtcccggcggatcggtccgaa
ctatcggtccctggcgagggccaaagcctaggaacaaatactaggaccaaagacgaggga
taa

DBGET integrated database retrieval system