KEGG   Corynebacterium jeikeium: jk0287Help
Entry
jk0287            CDS       T00255                                 

Definition
(GenBank) putative aldose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00010  Glycolysis / Gluconeogenesis
cjk00052  Galactose metabolism
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
cjk01120  Microbial metabolism in diverse environments
cjk01130  Biosynthesis of antibiotics
Module
cjk_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jk0287
   00052 Galactose metabolism
    jk0287
Enzymes [BR:cjk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     jk0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAI36439
UniProt: Q4JXL8
Position
349742..350734
Genome map
AA seq 330 aa AA seqDB search
MSDDLDTLQRHSHPFVDISAGEYRASISTFGGGLRSLEYAGKPLVVSYPEGAYPPLSSGI
VLAPWPNRTADGVFAHDGVLHRLDITEPGRATAIHGFVGQMAWHVADQGEDFVALELSTG
LRQGWPWPLRMRVTWSLDAAEGLRATFDVRNEADASCPFGLGWHPYLSALGAPLDDCVLH
LPVGTNLPLDSVRNLPAGPEFSARRVLPDLDTGQRMAGVWLDHCFGGISVQEDAPSEARL
LNPDGEGVRLWVGEGFNWFQVFTADPARREGYPGVGRALALEPMTCPPDALRSGRDLIRL
NAGEEFSFECGVSFAPREGVTTQEPKQFQK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgatctagacaccctgcagcgacactcgcaccccttcgtggatatttcagct
ggggagtaccgcgccagcatctccaccttcggtggcgggctgcgcagcctggagtacgcg
ggcaagcccctggtggtttcctacccagagggcgcctacccgccgctatcctccggaatt
gtgctggccccatggccgaaccgcacagccgacggggtcttcgcccacgacggcgtgctg
caccgtctggacatcacagagccgggccgcgccaccgcgatccacggattcgtggggcaa
atggcctggcacgttgccgaccaaggtgaagacttcgtggcgctggagctgtccaccggc
ctgcgccaggggtggccgtggccgctgcgtatgcgggtgacgtggtcgctcgatgcggct
gagggactgcgtgccactttcgacgtccgcaacgaggccgatgcttcctgccccttcggc
ctggggtggcacccatacctgagcgccctgggagcaccgctggatgactgcgtgctgcat
ctgcctgtcggcacgaacctgcccctggattcggtgcgcaaccttcccgccgggccggag
ttttcggctcgccgggtgcttccggacctggataccggccagcgcatggccggggtgtgg
ctggaccactgcttcggcggtatcagtgtgcaggaggatgcgccgtccgaggcgcgcctg
ctcaacccggacggcgagggcgtgcgtctatgggtaggcgagggcttcaactggtttcag
gtgttcactgccgacccagcccgccgcgagggctaccccggtgtggggcgggccctggcc
ctcgaaccgatgacgtgcccgccggacgcactacgctccggccgagacctcattcgcctg
aatgcaggggaggagttcagcttcgaatgtggggtctctttcgcgccgcgtgagggcgtc
acaacccaagaaccgaagcagttccagaagtag

DBGET integrated database retrieval system