KEGG   Corynebacterium jeikeium: jk0431Help
Entry
jk0431            CDS       T00255                                 

Gene name
echA2
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00071  Fatty acid degradation
cjk00280  Valine, leucine and isoleucine degradation
cjk00281  Geraniol degradation
cjk00310  Lysine degradation
cjk00360  Phenylalanine metabolism
cjk00362  Benzoate degradation
cjk00380  Tryptophan metabolism
cjk00410  beta-Alanine metabolism
cjk00627  Aminobenzoate degradation
cjk00640  Propanoate metabolism
cjk00650  Butanoate metabolism
cjk00903  Limonene and pinene degradation
cjk00930  Caprolactam degradation
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
cjk01120  Microbial metabolism in diverse environments
cjk01130  Biosynthesis of antibiotics
cjk01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    jk0431 (echA2)
   00650 Butanoate metabolism
    jk0431 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    jk0431 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    jk0431 (echA2)
   00310 Lysine degradation
    jk0431 (echA2)
   00360 Phenylalanine metabolism
    jk0431 (echA2)
   00380 Tryptophan metabolism
    jk0431 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    jk0431 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    jk0431 (echA2)
   00281 Geraniol degradation
    jk0431 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    jk0431 (echA2)
   00627 Aminobenzoate degradation
    jk0431 (echA2)
   00930 Caprolactam degradation
    jk0431 (echA2)
Enzymes [BR:cjk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     jk0431 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAI36588
UniProt: Q4JX69
Position
516129..516923
Genome map
AA seq 264 aa AA seqDB search
MSAGHVITHLETVEAGKASNADGFGHSAAPQVGVITLNRPEKRNALNAAIATVVAEAVRA
HTASGVRAILIRGEGPVFCAGADLSGGVYADEFWSAMEDMLSAIQTTPVPVIADVHGPAV
GAGCQIALACDLRAFADEGACWVPVAEHGFALDLWTHARARELMGGALARNVFLAGARVG
AEQARATGFSVVLDDATPNASALAHRVARQAPLSMEHSKRVFNSPDMHADAELQQMMVDI
WASEDVQEARRARAEKRAPQFRGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagggcacgtcatcactcatctagagaccgtcgaggcaggcaaagcgagcaat
gccgacggtttcggccattccgccgccccacaggtcggcgtgatcaccctcaaccgccca
gagaagcgcaatgccctcaatgccgccatcgccacagtcgtcgcagaggccgtccgcgcc
cacactgcctccggggtgcgtgccattttgattcgtggcgagggacctgttttctgcgcc
ggagcagacctttccggcggtgtgtacgccgatgaattttggtccgccatggaggacatg
ctctcggccatccagaccaccccggtgccggtcatcgcggatgttcacggtccggcggtc
ggcgcgggctgccaaatcgccttggcctgcgacctgcgcgcttttgccgacgagggtgcc
tgctgggtgcctgtagccgaacacggtttcgcgctggacctttggactcacgcccgcgcc
cgcgagttgatgggcggcgcactggctcgcaacgtgttcttggcaggcgcccgggtaggt
gccgaacaagctcgggcgacgggcttttctgtggttctggatgacgccacccccaacgcc
agcgcactagcgcatcgggtggcgcgccaggctccgctttctatggagcattcgaaacgc
gtgttcaacagcccagacatgcacgcggatgcggagctgcagcagatgatggtggacatc
tgggccagcgaggacgtacaggaggcgcgccgcgcccgcgccgagaaacgcgcgcctcag
ttcagaggccgttaa

DBGET integrated database retrieval system