KEGG   Corynebacterium jeikeium: jk0569Help
Entry
jk0569            CDS       T00255                                 

Gene name
gpmB
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cjk  Corynebacterium jeikeium
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cjk01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cjk01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cjk00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:cjk00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cjk00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
688675..689484
Genome map
AA seq 269 aa AA seqDB search
MGERRVFLVRHGQTEYNATGRMQGQLDTDLSPVGVQQAKVTAQMLGDKRIARVIASDLKR
AYDTALILAEPFGCEVTTDTRLRETDLGQWQGASREEVDRDFPGQRAYWRHDPQWAPPGG
ETRLEVAERAYAVIEEIMATDIFDDGDVMIVAHGGTIGALTARLLDLPVRYYPVFTGLGN
ACWSQLLARPRFTGEATGTTPVAVDGSTVPLVPSSRADWWKLPQWHLEGWNLGVATDASP
DEGALPGAGPSSFGNDAARSNPHNPSEGR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcgcagggtctttttggtccgtcacggacagacggagtacaacgccacgggg
cgtatgcagggacagctggatactgacctgtccccggtgggtgtgcagcaggccaaggtc
actgcgcagatgctgggggataagcgcatcgcgcgggtgatcgccagcgaccttaagcgt
gcctacgatacggcgctgatcctggccgagcctttcggctgcgaggtgaccaccgatacc
cgcctgcgggagacggacctggggcagtggcagggggcctcgcgcgaagaggttgaccgc
gacttcccaggccagcgtgcgtattggcgccacgatccccagtgggctcctccgggtggc
gagacgcgcctggaggtcgccgagcgcgcctacgccgtgatcgaggagatcatggctacc
gatatcttcgacgacggcgacgtgatgatcgtcgcccacggtggcacgatcggtgcgctt
accgcccgcctgctggaccttccggtgcgctactacccggtgttcaccggcctgggtaat
gcctgctggtcgcagctgttggcccgcccgcgttttaccggcgaggcgacgggcaccacc
ccggtagcggtcgacggaagcacggtgccgctggtaccttccagccgcgccgactggtgg
aagctgccacagtggcacctggagggctggaacttgggcgtggccaccgacgcaagcccg
gacgagggtgcccttccaggtgctggccccagttcttttggtaatgacgccgcccgctcc
aacccgcacaaccccagcgaaggtaggtag

DBGET integrated database retrieval system