KEGG   Corynebacterium jeikeium: jk0569Help
Entry
jk0569            CDS       T00255                                 

Gene name
gpmB
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cjk  Corynebacterium jeikeium
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    jk0569 (gpmB)
   01230 Biosynthesis of amino acids
    jk0569 (gpmB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jk0569 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    jk0569 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    jk0569 (gpmB)
Enzymes [BR:cjk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     jk0569 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
688675..689484
Genome map
AA seq 269 aa AA seqDB search
MGERRVFLVRHGQTEYNATGRMQGQLDTDLSPVGVQQAKVTAQMLGDKRIARVIASDLKR
AYDTALILAEPFGCEVTTDTRLRETDLGQWQGASREEVDRDFPGQRAYWRHDPQWAPPGG
ETRLEVAERAYAVIEEIMATDIFDDGDVMIVAHGGTIGALTARLLDLPVRYYPVFTGLGN
ACWSQLLARPRFTGEATGTTPVAVDGSTVPLVPSSRADWWKLPQWHLEGWNLGVATDASP
DEGALPGAGPSSFGNDAARSNPHNPSEGR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcgcagggtctttttggtccgtcacggacagacggagtacaacgccacgggg
cgtatgcagggacagctggatactgacctgtccccggtgggtgtgcagcaggccaaggtc
actgcgcagatgctgggggataagcgcatcgcgcgggtgatcgccagcgaccttaagcgt
gcctacgatacggcgctgatcctggccgagcctttcggctgcgaggtgaccaccgatacc
cgcctgcgggagacggacctggggcagtggcagggggcctcgcgcgaagaggttgaccgc
gacttcccaggccagcgtgcgtattggcgccacgatccccagtgggctcctccgggtggc
gagacgcgcctggaggtcgccgagcgcgcctacgccgtgatcgaggagatcatggctacc
gatatcttcgacgacggcgacgtgatgatcgtcgcccacggtggcacgatcggtgcgctt
accgcccgcctgctggaccttccggtgcgctactacccggtgttcaccggcctgggtaat
gcctgctggtcgcagctgttggcccgcccgcgttttaccggcgaggcgacgggcaccacc
ccggtagcggtcgacggaagcacggtgccgctggtaccttccagccgcgccgactggtgg
aagctgccacagtggcacctggagggctggaacttgggcgtggccaccgacgcaagcccg
gacgagggtgcccttccaggtgctggccccagttcttttggtaatgacgccgcccgctcc
aacccgcacaaccccagcgaaggtaggtag

DBGET integrated database retrieval system