KEGG   Corynebacterium jeikeium: jk0569Help
Entry
jk0569            CDS       T00255                                 

Gene name
gpmB
Definition
(GenBank) putative phosphoglycerate mutase
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
cjk  Corynebacterium jeikeium
Brite
Enzymes [BR:cjk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     jk0569 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
688675..689484
Genome map
AA seq 269 aa AA seqDB search
MGERRVFLVRHGQTEYNATGRMQGQLDTDLSPVGVQQAKVTAQMLGDKRIARVIASDLKR
AYDTALILAEPFGCEVTTDTRLRETDLGQWQGASREEVDRDFPGQRAYWRHDPQWAPPGG
ETRLEVAERAYAVIEEIMATDIFDDGDVMIVAHGGTIGALTARLLDLPVRYYPVFTGLGN
ACWSQLLARPRFTGEATGTTPVAVDGSTVPLVPSSRADWWKLPQWHLEGWNLGVATDASP
DEGALPGAGPSSFGNDAARSNPHNPSEGR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcgcagggtctttttggtccgtcacggacagacggagtacaacgccacgggg
cgtatgcagggacagctggatactgacctgtccccggtgggtgtgcagcaggccaaggtc
actgcgcagatgctgggggataagcgcatcgcgcgggtgatcgccagcgaccttaagcgt
gcctacgatacggcgctgatcctggccgagcctttcggctgcgaggtgaccaccgatacc
cgcctgcgggagacggacctggggcagtggcagggggcctcgcgcgaagaggttgaccgc
gacttcccaggccagcgtgcgtattggcgccacgatccccagtgggctcctccgggtggc
gagacgcgcctggaggtcgccgagcgcgcctacgccgtgatcgaggagatcatggctacc
gatatcttcgacgacggcgacgtgatgatcgtcgcccacggtggcacgatcggtgcgctt
accgcccgcctgctggaccttccggtgcgctactacccggtgttcaccggcctgggtaat
gcctgctggtcgcagctgttggcccgcccgcgttttaccggcgaggcgacgggcaccacc
ccggtagcggtcgacggaagcacggtgccgctggtaccttccagccgcgccgactggtgg
aagctgccacagtggcacctggagggctggaacttgggcgtggccaccgacgcaagcccg
gacgagggtgcccttccaggtgctggccccagttcttttggtaatgacgccgcccgctcc
aacccgcacaaccccagcgaaggtaggtag

DBGET integrated database retrieval system