KEGG   Corynebacterium jeikeium: jk0590Help
Entry
jk0590            CDS       T00255                                 

Definition
hypothetical protein
Orthology
K15372  
taurine---2-oxoglutarate transaminase [EC:2.6.1.55]
Organism
cjk  Corynebacterium jeikeium
Pathway
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cjk00410]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:cjk00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(711825..713213)
Genome map
AA seq 462 aa AA seqDB search
MTEFPPSITEFTTFDGSKVGVGTEEATAAERQVRDNDSNYVFHSWSAQEKINPQPLSHAE
GVWIYDYQGNGYLDLGSQLVSANLGHAHPKLVEAIQQQATRITNQNPAFSNDVRSELAKE
IVEQAQGDFSHVFFTNGGADAIEHAIRMARLTTGKSKILTAYRSYHGATGSAIMATGEAR
RHGNPTTDGDVKHFWGPFLYRSAFYSSTQEEECARALQSLEETLVYEDNVAAVLIESVVG
SSGIIVPPEGFLQGVREICDRHGALYIADEVMVGFGRTGKMFAYEHGGKNLQPDLVTFAK
GVNSGMAPLGGVMMNEAVYQRFADKPYPGGLTYSGHPLAAAPGLAAQKVYREENIFEKVA
ELGERVIAPAMEKIAENHPSVGNVRGKGFFWAIEFVSDQEAKTPMGGEAMAAFGAELKKA
GIWPMVSGHRLHFAPPLITTEEQLNWALEIVDRAAAVVDQAL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattcccccctagtatcaccgagttcactaccttcgacggctcaaaagtgggc
gtcggcaccgaagaagcaacggccgcagagcgacaggtacgcgacaacgacagcaactac
gtattccacagctggtcggcgcaagagaagatcaacccgcagccgctcagccacgcggag
ggcgtgtggatctacgattatcagggcaatggctacctggacctgggcagccagctggtc
agcgccaacctgggccacgcgcacccgaagctggtagaggcaattcagcagcaagcaacc
cgcatcaccaaccagaaccccgcgttctccaacgacgtgcgcagcgagctggccaaggag
atcgtggagcaggcgcagggcgacttctcccacgtgttcttcaccaacggcggcgcggac
gccatcgagcacgccatccgcatggcgcgcctaactaccggcaagtccaagatcctgacg
gcctaccgcagctaccacggcgctaccggctccgcgattatggccaccggtgaggctcgc
cgccacggcaaccccaccactgacggcgacgtgaagcacttctggggcccgttcttgtac
cgcagcgccttctactcctccacgcaggaggaagagtgcgctcgcgctctccagtctctg
gaggaaaccctggtgtacgaggacaacgtggctgccgtgctgatcgagtccgtcgtgggt
tccagcggcatcatcgtcccgccggagggcttcctgcagggtgtgcgcgagatctgcgac
cgccatggtgcgctgtacatcgccgacgaggtcatggtcggcttcggccgtaccggcaag
atgttcgcctacgagcatggcggcaagaatctgcagccagacctggttaccttcgccaag
ggcgtgaactccggcatggcgccgctgggtggcgtgatgatgaacgaggccgtctaccag
cgcttcgccgacaagccttacccgggcggcctgacctactccggtcaccccctggctgcc
gcgcctggcctggcggcacagaaggtctaccgcgaggagaacatcttcgagaaggtcgcc
gagctgggcgagcgcgtgatcgctccggcaatggagaagatcgcggagaaccacccgagc
gtgggcaacgtccgtggcaagggcttcttctgggccatcgagttcgttagcgaccaggag
gccaagaccccgatgggtggcgaggccatggctgcgttcggcgccgagctgaagaaggcc
ggcatctggccgatggtttccggccaccgcctgcacttcgctccgccgctgatcaccact
gaggagcagctgaactgggcgctggagatcgtcgaccgcgcggcagcggtcgtcgaccag
gcgctgtaa

DBGET integrated database retrieval system