KEGG   Corynebacterium jeikeium: jk0590Help
Entry
jk0590            CDS       T00255                                 

Definition
hypothetical protein
Orthology
K15372  
taurine---2-oxoglutarate transaminase [EC:2.6.1.55]
Organism
cjk  Corynebacterium jeikeium
Pathway
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    jk0590
   00430 Taurine and hypotaurine metabolism
    jk0590
Enzymes [BR:cjk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.55  taurine---2-oxoglutarate transaminase
     jk0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(711825..713213)
Genome map
AA seq 462 aa AA seqDB search
MTEFPPSITEFTTFDGSKVGVGTEEATAAERQVRDNDSNYVFHSWSAQEKINPQPLSHAE
GVWIYDYQGNGYLDLGSQLVSANLGHAHPKLVEAIQQQATRITNQNPAFSNDVRSELAKE
IVEQAQGDFSHVFFTNGGADAIEHAIRMARLTTGKSKILTAYRSYHGATGSAIMATGEAR
RHGNPTTDGDVKHFWGPFLYRSAFYSSTQEEECARALQSLEETLVYEDNVAAVLIESVVG
SSGIIVPPEGFLQGVREICDRHGALYIADEVMVGFGRTGKMFAYEHGGKNLQPDLVTFAK
GVNSGMAPLGGVMMNEAVYQRFADKPYPGGLTYSGHPLAAAPGLAAQKVYREENIFEKVA
ELGERVIAPAMEKIAENHPSVGNVRGKGFFWAIEFVSDQEAKTPMGGEAMAAFGAELKKA
GIWPMVSGHRLHFAPPLITTEEQLNWALEIVDRAAAVVDQAL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattcccccctagtatcaccgagttcactaccttcgacggctcaaaagtgggc
gtcggcaccgaagaagcaacggccgcagagcgacaggtacgcgacaacgacagcaactac
gtattccacagctggtcggcgcaagagaagatcaacccgcagccgctcagccacgcggag
ggcgtgtggatctacgattatcagggcaatggctacctggacctgggcagccagctggtc
agcgccaacctgggccacgcgcacccgaagctggtagaggcaattcagcagcaagcaacc
cgcatcaccaaccagaaccccgcgttctccaacgacgtgcgcagcgagctggccaaggag
atcgtggagcaggcgcagggcgacttctcccacgtgttcttcaccaacggcggcgcggac
gccatcgagcacgccatccgcatggcgcgcctaactaccggcaagtccaagatcctgacg
gcctaccgcagctaccacggcgctaccggctccgcgattatggccaccggtgaggctcgc
cgccacggcaaccccaccactgacggcgacgtgaagcacttctggggcccgttcttgtac
cgcagcgccttctactcctccacgcaggaggaagagtgcgctcgcgctctccagtctctg
gaggaaaccctggtgtacgaggacaacgtggctgccgtgctgatcgagtccgtcgtgggt
tccagcggcatcatcgtcccgccggagggcttcctgcagggtgtgcgcgagatctgcgac
cgccatggtgcgctgtacatcgccgacgaggtcatggtcggcttcggccgtaccggcaag
atgttcgcctacgagcatggcggcaagaatctgcagccagacctggttaccttcgccaag
ggcgtgaactccggcatggcgccgctgggtggcgtgatgatgaacgaggccgtctaccag
cgcttcgccgacaagccttacccgggcggcctgacctactccggtcaccccctggctgcc
gcgcctggcctggcggcacagaaggtctaccgcgaggagaacatcttcgagaaggtcgcc
gagctgggcgagcgcgtgatcgctccggcaatggagaagatcgcggagaaccacccgagc
gtgggcaacgtccgtggcaagggcttcttctgggccatcgagttcgttagcgaccaggag
gccaagaccccgatgggtggcgaggccatggctgcgttcggcgccgagctgaagaaggcc
ggcatctggccgatggtttccggccaccgcctgcacttcgctccgccgctgatcaccact
gaggagcagctgaactgggcgctggagatcgtcgaccgcgcggcagcggtcgtcgaccag
gcgctgtaa

DBGET integrated database retrieval system