KEGG   Corynebacterium jeikeium: jk0596Help
Entry
jk0596            CDS       T00255                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cjk  Corynebacterium jeikeium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cjk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(720479..722647)
Genome map
AA seq 722 aa AA seqDB search
MAVVTSSVEPGGQIAPDVNAILNELAAECGVATWYTGQDGQRVDVKSSTVLFALRELGLD
LPEDPAALTEEIAQAAIEDLLHTRYSRMIAPTITAIADRPRTLHVHCIDGESLQVQVHTE
DGDTIELEQLNEWVDPITVGAEDTATTFGTATFQLPALPAGWHQLEACADSTEATSTLLV
SPQSLELPDAPRTGVMAQLYSLRDKDAWGIGDYGTLEVLSDSLQKLGGADFVLVNPMHAA
EAAPPVEDSPYLPTTRRYTNPIYIRVENTPEYAAHPELHTEIEQLAAPLKKRNHTADLLD
RDPVVASKIKALHLLYSAGIGDERAEQLRAFREREGEGLVGFTEWCERAANDPALTSDFY
AWMQMLCQEQELHAQNTLTEHMSIGLMADLAVGVHPGGADSQTLADVLAPGASVGAPPDG
YNQQGQDWSQPPWHPWKLAEEGYRPWRDMLRTILRTAGGIRIDHVLGLFRLWWIPRMESP
TLGTYVTYDHEALVGALVLEAHRAGAVVVGEDLGTFEPWVQDYLASRGVMGTSIVWFEGD
ANGAKPPEAYRRTCLTSVTTHDLPPTASYLRGGHIDLREELGVLTRSADDEFAEDANWQV
DVLGTIARHGGFHGMDCEGYFLNDLRQELDDPRHGRERRPDVSYILRAMHRYIAQTPSLL
RCAALVDLVGDLRAQNQPGTTQDLYPNWRVPLCDGEGNPVLVEDLADMPLARDVLAATRG
EG
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgtgactagctctgtggaacccggcggacagatcgcccccgatgtcaacgca
atcctcaacgaactggctgccgaatgcggcgtggccacctggtacaccggccaggacggc
cagcgggtggatgtgaaaagcagcactgtacttttcgcgctccgcgagttgggactggat
ctgccggaggatcccgccgcactgaccgaagagattgcacaggcggccatcgaggatcta
ctgcacacccgctacagccgcatgatcgcccccaccatcaccgccatcgccgaccgcccg
cgcaccttgcatgtccactgcatcgacggcgaatccctgcaggtgcaggtccatactgaa
gacggcgacacgatcgagctggaacagctcaacgaatgggtggaccccatcaccgtcggc
gccgaagacaccgccaccaccttcggcacggctacgttccagctgcccgccctgcccgcc
ggctggcaccagctcgaggcttgcgccgactccacggaggctacctcgaccctgctggtc
tctccccaatccctggaactgccggatgccccgcgcaccggagtgatggcgcagctgtat
tccctgcgtgacaaggacgcctggggcatcggcgactacggcactctcgaggttctgagc
gattccctacagaagctcggcggggcggacttcgtactggtgaaccccatgcacgcagca
gaagcagctcccccggtggaggattccccctacctgcccaccacccgccgctacacgaac
cctatttacatccgggtagagaacacacccgagtacgcggcacaccccgaactacacacg
gagatcgagcagctcgccgccccgctgaagaagcgcaaccacacggctgacctgttggat
cgggaccccgtggtggcgtccaaaatcaaagcccttcacctgttgtattccgcagggatc
ggcgacgagcgtgcggaacaactacgtgccttccgcgagcgcgaaggcgaggggctggtg
ggcttcaccgaatggtgcgagcgcgcagccaacgacccggcgctgactagcgacttttac
gcctggatgcagatgctctgccaggagcaggagctgcacgctcaaaacaccctgaccgaa
cacatgagcatcgggctgatggcagatctggccgtgggcgtgcaccccggcggcgcggac
tcgcagacgctagccgacgtgctggcgcctggagctagcgtgggcgccccgccggatggc
tacaaccagcaggggcaggactggtcgcagccgccgtggcacccctggaagctggctgaa
gagggctatcgcccgtggcgcgacatgctacgtacgatcctgcgcaccgccggtggcatc
cgcatcgaccacgtactggggcttttccgcctgtggtggatcccgcggatggaatcgccg
acgctcggtacttacgtcacctacgaccacgaggctctggtcggcgccctggtgctggaa
gctcaccgcgccggtgccgtggtggtcggcgaggatctgggcactttcgagccctgggtc
caggattacctggccagccgcggggtgatgggaacctcgatcgtgtggtttgagggtgac
gccaacggggcgaagccgccggaggcctaccgccgtacctgcctgacctccgtaaccaca
cacgatctacctccgaccgccagctacctgcgaggcggtcacatcgacctgcgcgaagag
ctgggggttttgacccgcagcgcggacgacgaattcgccgaggatgccaattggcaagta
gacgtgctgggtaccatcgcccgacacggtggcttccacggcatggactgtgagggttac
ttcctcaacgacctacgccaagagctggacgatccgcggcacgggcgtgagcgccgcccg
gatgtttcgtacatcctgcgcgccatgcaccgctacattgcgcagaccccgtcgctgctg
cgttgcgccgcgctagtggatctggtgggcgacctgcgcgcgcagaaccagccgggcacc
acgcaggacctgtatccaaactggcgcgttccgctgtgcgacggcgagggcaacccggtg
ctcgtggaggatctggcggacatgccgctggctcgcgacgtgctggccgccacccgcggc
gagggttag

DBGET integrated database retrieval system