KEGG   Corynebacterium jeikeium: jk0629Help
Entry
jk0629            CDS       T00255                                 

Gene name
choE
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cjk  Corynebacterium jeikeium
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    jk0629 (choE)
Enzymes [BR:cjk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     jk0629 (choE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(756296..758065)
Genome map
AA seq 589 aa AA seqDB search
MTDSQATSQANSQATGNSSTHYDVLIIGSGFGGSTTALRLVEKGYKVGILEAGRRFKDEE
FAKNSWHLKDFLWMPQIGLYGIQRIHLLKDVMILAGAGVGGGSLNYANTLYQPGEAYFND
KQWNTITDWEDELTPYYQQAQKMLGVVENPTMTPADVYSKKVAEEMGVGDTFRMAPVGVF
FGEKVGLEGKPCETVKDPYFGGVGPDRTACHECGECMTGCRHGAKNTLLKNYLYLAERGG
AKVHDRTTVTDITFDGTTWTVQAKQTGPITKRNPQTSSFTADNLVVAAGTWGTQNLLHRQ
KANGNLPKLSDKLGHLTRTNSEALLGANRSDYSPDMDFSEGVAITSSYFPAPDTHIEPVR
YGKGSNAMGLLQTLMTDGDKLQPRFLEFIKQVFLQYKAIPRLVNLNKWSQRTVINLVMQT
RDNSLRTFLRKIGPFNMLSSEQGTGEPNPTWIPEGNTATRILAKLLPKGVAGGVWSEVFN
IPLTAHFLGGCVIGSSPEHGVVDPYHRAWGYPSLFITDGSAITANPGVNPSLSITANAER
AAAMWPNKGEADPRPPQSEGYRRINPVQPNNPIVPDDAPAALRLPLRVL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgactgactcgcaggccacctcgcaggctaattcgcaggccaccggcaactcctccacc
cactacgacgtgctgatcatcggctccggcttcggcggctccactaccgccctgcgcctg
gtggagaagggttacaaggttggcatcctcgaggccggccgtcgcttcaaggacgaagag
ttcgccaagaactcctggcacctcaaggacttcctgtggatgccgcagatcggcctgtac
ggcatccagcgcatccacctgctcaaggacgtgatgatcctcgctggcgcgggcgtgggc
ggcggctcgctgaactacgcgaacacgctctaccagccgggcgaggcatacttcaacgac
aagcagtggaacaccatcaccgactgggaagacgagctgaccccctactaccagcaagcc
caaaagatgctcggcgtggtggaaaaccccaccatgacccccgccgacgtgtactccaag
aaggttgccgaggagatgggcgtgggcgacacattccgcatggcgcccgtcggagtcttc
tttggagaaaaggtcgggctcgaaggtaagccgtgtgagactgtgaaggatccatacttc
ggcggcgttggccccgatcgcaccgcttgccacgagtgcggcgagtgcatgaccggctgc
cgccacggcgcgaagaataccctgctgaagaactacctgtacctggccgagaggggcggg
gcgaaggtgcatgaccgcacgaccgtcaccgacatcaccttcgacggcaccacctggacg
gtgcaggccaagcagaccgggccgatcaccaagcgcaacccgcagaccagcagcttcacc
gccgataaccttgtcgtcgccgcgggcacctggggcacccagaacctgctgcaccgccag
aaggccaacggcaacctgccgaagctgtcagacaagctggggcaccttacccgcacgaac
tccgaggcgctgctgggcgcgaaccgttcggactactcccccgacatggatttctccgag
ggcgtggccatcacatcttcctacttccccgccccggatacccacatcgagccggtgcgt
tacggcaagggctccaacgcgatgggcctgctgcagaccctcatgactgacggcgataag
ctgcagccccgcttcctggagttcatcaaacaggtcttcctgcagtacaaggccatcccg
cgcctggtgaacttgaacaagtggtcgcagcgcaccgtcatcaacctggtgatgcagacc
cgcgataactcgctgcgcaccttcctgcgcaagatcggcccgttcaacatgctgagctcc
gagcagggcaccggcgagccgaaccccacctggatccccgagggcaacacagccacccga
atcctggcgaagctgctgccgaagggtgttgctggcggcgtgtggtcggaggtgttcaac
atcccgctgaccgcgcacttcctaggcggctgcgtgatcggctcctcgcctgagcacggc
gtggtggacccctaccaccgcgcgtggggctacccgagcttgttcatcaccgacggttcc
gccatcaccgcgaacccgggcgtgaacccctccctgtccatcaccgcgaatgccgagcgt
gctgccgccatgtggccgaacaagggcgaggccgacccgcgcccgccgcagtccgagggc
taccgccgcattaacccagtgcagccgaacaacccgatcgttccggacgacgccccggcc
gccctccggctgccactgcgcgtgctctaa

DBGET integrated database retrieval system