KEGG   Corynebacterium jeikeium: jk0707Help
Entry
jk0707            CDS       T00255                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cjk  Corynebacterium jeikeium
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    jk0707 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    jk0707 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    jk0707 (aceF)
Enzymes [BR:cjk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     jk0707 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(843846..845975)
Genome map
AA seq 709 aa AA seqDB search
MAYSVEMPELGESVTEGTVTQWLKKVGDKVSVDEPLLEVSTDKVDTEIPSPASGVLLKII
ADEDDTVDVGAVIAEIGEEGEEPSGSDADSSSDDDSSDAAEDSSESGSESSDNSGAESGS
GSASGEAEDVTMPELGESVTEGTITQWLKKVGDKVEVDEPLLEVSTDKVDTEIPSPVAGT
LVEILANEDDTVDVGAVIARIGDEGAAKSGSSDSSDSSDSSSSKADESESKESSEPSDSS
SAESSDNSGSGSGEAEDVTMPELGESVTEGTITQWLKKVGDKVEVDEPLLEVSTDKVDTE
IPSPVAGTLVEILANEDDTVDVGAVIARIGDEAAAKSGSSKSDESVTEDKAEPKAEEKKA
EAKQAEEKAEAKTETKSEPKAEAKPSKPAAQQSKPAEGNLPYVTPLVRKLAEKHGVDLSS
VEGTGVGGRIRKQDILAAAEGTSASGSSAKSASPAGPRASSYKVDPAKQELRGTTKKVSR
IREITAKTTLDSLHAAAQLTQVHEVDMTRVAELRKANKQAFADKHGVNLTYLPFFAKAAV
EALISHPNVNASYNAQTKEMTYHEQVNLGIAVDTEAGLLSPVIHNAQDMSLPELAQAIVD
IADRARNKKLKPNDLSGGTFTITNIGSEGALTDTPILVPPQAAMIGTGAIVKRPVVLSED
EGEAIAIRQMVFLPMTYDHQVIDGADAGRFMSTLRDRLENSDFTEDLEL
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggcgtactccgtcgaaatgcccgaactgggcgagtccgtaaccgagggcaccgttact
cagtggctgaagaaggtcggagacaaggtctccgtcgacgaaccgttgctggaggtatcg
accgacaaggttgatacggagatcccttcccccgcaagtggtgtgctgctgaagatcatc
gctgacgaagacgacactgtggatgtcggcgccgtcatcgccgagatcggtgaggagggc
gaagagccttctggttctgacgccgacagctccagcgacgacgattccagcgacgctgcc
gaggattccagcgagtccggctctgagtcttccgacaactctggcgctgagtctggttcc
ggctccgcctccggtgaggccgaggacgttaccatgccggagctcggcgagtccgtcacc
gagggcaccatcacccagtggctgaagaaggtcggcgacaaggttgaggtcgacgagccg
ctgctcgaggtctccaccgacaaggtcgacaccgagatcccgtccccggtcgccggcacc
ctggtggagatcctggccaacgaggatgacaccgtagacgtcggcgcagtcatcgcccgc
atcggcgacgagggcgccgccaagtccggatcctctgactcctccgattcttccgactcc
agctcctccaaggccgatgagtctgagtccaaggagtcctccgagcccagcgattccagc
tccgccgagtcctctgataactctggctctggttccggcgaggccgaggacgtcaccatg
ccggagctcggcgagtccgtcaccgagggcaccatcacccagtggctgaagaaggtcggc
gacaaggttgaggtcgacgagccactgctcgaggtctccaccgacaaggtcgacaccgag
atcccgtccccggtcgccggcaccctggtggagatcctggccaacgaagatgacaccgta
gacgtcggcgcagtcatcgcccgcatcggcgacgaggccgccgccaagtccggctcctcc
aagtccgacgagtctgtcaccgaggacaaggccgagccgaaggcggaggaaaagaaggct
gaggctaagcaggccgaagagaaggctgaagccaagactgaaacaaagtccgagcccaag
gccgaggccaagccctccaagcctgctgcacagcagtcgaagcctgccgagggcaacctc
ccctacgtcactccgctggtgcgcaagctggctgagaagcatggcgtcgatctgtcgagc
gtcgagggaaccggcgtcggcggccgtatccgcaagcaggacatcctggccgcagcagaa
ggcacctccgcttccggctcctctgcgaagtccgcttccccggctggccctcgcgcttcc
tcctacaaggtcgacccggccaagcaggagctgcgcggcaccactaagaaggtcagccgc
atccgcgagatcaccgcgaagaccaccctggattccctgcacgctgcagctcagctgacg
caggtccacgaggtcgacatgactcgcgtggcggaactgcgcaaggccaacaagcaggcc
tttgccgacaagcacggtgtgaacctgacctacctgccgttcttcgcaaaggcagcggtc
gaggctctgatttcccacccgaacgtcaacgcctcctacaacgcgcagaccaaggagatg
acctaccacgagcaggtcaacctgggcatcgctgtcgacacggaggctggcctgctgagc
ccggttatccacaacgcgcaggacatgtccctgccggagctggctcaggccatcgtcgac
attgctgaccgtgcgcgcaacaagaagctgaagccgaacgacctgtccggcggcaccttc
accatcaccaacattggttccgagggcgccctgaccgataccccgattctggttccgccg
caggctgccatgatcggcaccggcgccatcgtgaagcgcccggtggtgctgagtgaggac
gagggcgaggctatcgccatccgccagatggtcttcctgccgatgacctacgaccaccag
gtcatcgacggcgccgacgcaggccgcttcatgtccaccctgcgtgaccgcctggagaac
tcggacttcaccgaggacctggagctctaa

DBGET integrated database retrieval system