KEGG   Corynebacterium jeikeium: jk0728Help
Entry
jk0728            CDS       T00255                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cjk  Corynebacterium jeikeium
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:cjk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cjk00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cjk00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cjk00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cjk00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cjk00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
868495..869463
Genome map
AA seq 322 aa AA seqDB search
MTGTLTVGVDIGGTNLRAAVVDADGQILDIEKLPTPSNVYALETALVHAINCLQRRNEGI
VAVGLAVAGFINSQRDTVRFAPHLPWRNAQVTERLSAKLGLPVELEHDANSAALGEYYLG
AAQNAGTWVLFALGTGIGGAVMVNGEIYRGAFGTAPEFGHLTVMPGGRACPCGKQGCLER
YCSGSALALTAQDLIATGRYPDSAITREFAQHPEEISGRTIVRLAREGDPLARAAIEDMG
LWLGRGLSLVQDVFDPELIVIGGGVSSDADLFLDQAESMMNYSIVGAGHRPVAEVKTAQL
GGDAGMIGVALLARKHLERGAE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgactgggaccctaaccgtgggcgtggacatcggtggcacgaacctgcgcgccgccgta
gtagacgcggacgggcagatcctggacatcgagaaactacccacgccctctaacgtgtac
gcgctggagaccgctttggtgcacgccatcaactgcctacagcgccgcaacgaaggtatt
gtggcggttggtctggccgtggcggggttcattaactcccagcgcgataccgtgcgcttc
gccccgcacctgccgtggcgcaacgcacaggtgaccgagcgcctgagtgccaagttgggg
ctgccggtggagctggagcacgacgcaaactcggcagcgttgggggagtactacctggga
gccgcacagaacgcggggacttgggttctgttcgcgctgggtactggcatcggtggcgcc
gtgatggtgaatggggagatctaccgcggagccttcggcaccgccccggagtttgggcac
ctgactgtaatgccgggcggacgggcgtgcccctgtggcaagcagggctgtctggagcgc
tactgctccggctcggcgctggcgctgacggcgcaggacctgattgcaaccggtcgctac
ccggattcggccatcacccgcgagtttgcgcagcacccggaggagatctccggccggacg
atcgtgcgcctagctagggagggcgatccactggcccgcgcggccattgaggacatgggc
ctgtggctggggcgtgggctgtcgctggtgcaggacgtgtttgatccggagttgattgtg
ataggcgggggagttagctccgacgcggatctgttcttggaccaagcggaatccatgatg
aactacagcatcgtcggcgctggccaccgcccggtggcagaagtgaagaccgcgcagttg
ggcggcgatgccggtatgatcggcgtggcgctgctggcacgcaagcatcttgagcgtggc
gctgaataa

DBGET integrated database retrieval system