KEGG   Corynebacterium jeikeium: jk0797Help
Entry
jk0797            CDS       T00255                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase (EC 4.1.1.48) (IGPS).
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
cjk01130  Biosynthesis of antibiotics
cjk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    jk0797 (trpC)
Enzymes [BR:cjk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     jk0797 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase NanE QRPTase_C IMPDH
Motif
Other DBs
NCBI-ProteinID: CAI36959
UniProt: Q4JW48
Position
950304..951191
Genome map
AA seq 295 aa AA seqDB search
MRGWIRPKNPISPAPSRGDKLRGVTHMTVLDQIIAGVLDDQAEREAKIPYKEIKAMSLDA
PPALDAHAALAAPGVSLIAEVKRASPSKGDLAEIADPEVLAKAYEDNGATAISCLTEQRR
FKGSLEDFDAVRRAVNIPLLRKDFTVNPYQIHEARAHGADIVLLIVAALEQQRLESLLDR
TESLGMTALVEVHTAEEAERAVAAGAKVIGVNARNLKTLDVDPQVFSKIAPLLPDDVVKI
AESGVKNKNDLNAYAAAGADAVLVGEGLVTAGNPAQACRDLAAAGKHPACPQKNS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgggggtggatccgaccgaagaatccgatttctcccgcaccaagcaggggcgataag
ctcaggggtgtgacacacatgactgttctcgaccagatcattgccggggtgctagacgac
caggccgagcgggaagccaagatcccatacaaggagatcaaggccatgtccctggacgca
ccaccggctctcgacgcccacgccgcgctggccgcccccggggtcagcctcattgccgag
gtgaagcgcgccagcccctccaagggggacctcgccgagatcgccgatcccgaagtgctg
gcgaaggcctacgaggacaatggggccaccgccatcagctgcctcaccgaacagcgccgc
ttcaagggctccctcgaggacttcgacgcggtgcgccgggcggtgaacattccgctgctg
cgcaaggacttcacggtgaacccgtaccagatccacgaggcccgggcgcacggcgcggac
atcgtgctgctcatcgtcgctgcactcgaacagcagcgcctggaatccttgctggatcga
accgagtccctgggtatgaccgccctggtggaagtgcacaccgccgaagaagccgagcgc
gctgttgccgccggtgccaaggtcattggggtcaatgcccgaaacctcaagacgctggac
gtcgacccgcaggtgttcagcaagattgccccgctgcttccggacgacgtggtgaagatc
gcagagtcgggcgtcaagaataaaaacgacctcaacgcctatgccgcagcgggcgcggac
gcagtgctcgtcggcgaaggcctggtcaccgcaggtaaccccgcccaggcgtgccgggac
ctcgccgcagcgggaaaacacccagcctgcccccaaaagaattcctaa

DBGET integrated database retrieval system