KEGG   Corynebacterium jeikeium: jk0797Help
Entry
jk0797            CDS       T00255                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase (EC 4.1.1.48) (IGPS). (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cjk  Corynebacterium jeikeium
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    jk0797 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    jk0797 (trpC)
Enzymes [BR:cjk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     jk0797 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
950304..951191
Genome map
AA seq 295 aa AA seqDB search
MRGWIRPKNPISPAPSRGDKLRGVTHMTVLDQIIAGVLDDQAEREAKIPYKEIKAMSLDA
PPALDAHAALAAPGVSLIAEVKRASPSKGDLAEIADPEVLAKAYEDNGATAISCLTEQRR
FKGSLEDFDAVRRAVNIPLLRKDFTVNPYQIHEARAHGADIVLLIVAALEQQRLESLLDR
TESLGMTALVEVHTAEEAERAVAAGAKVIGVNARNLKTLDVDPQVFSKIAPLLPDDVVKI
AESGVKNKNDLNAYAAAGADAVLVGEGLVTAGNPAQACRDLAAAGKHPACPQKNS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgggggtggatccgaccgaagaatccgatttctcccgcaccaagcaggggcgataag
ctcaggggtgtgacacacatgactgttctcgaccagatcattgccggggtgctagacgac
caggccgagcgggaagccaagatcccatacaaggagatcaaggccatgtccctggacgca
ccaccggctctcgacgcccacgccgcgctggccgcccccggggtcagcctcattgccgag
gtgaagcgcgccagcccctccaagggggacctcgccgagatcgccgatcccgaagtgctg
gcgaaggcctacgaggacaatggggccaccgccatcagctgcctcaccgaacagcgccgc
ttcaagggctccctcgaggacttcgacgcggtgcgccgggcggtgaacattccgctgctg
cgcaaggacttcacggtgaacccgtaccagatccacgaggcccgggcgcacggcgcggac
atcgtgctgctcatcgtcgctgcactcgaacagcagcgcctggaatccttgctggatcga
accgagtccctgggtatgaccgccctggtggaagtgcacaccgccgaagaagccgagcgc
gctgttgccgccggtgccaaggtcattggggtcaatgcccgaaacctcaagacgctggac
gtcgacccgcaggtgttcagcaagattgccccgctgcttccggacgacgtggtgaagatc
gcagagtcgggcgtcaagaataaaaacgacctcaacgcctatgccgcagcgggcgcggac
gcagtgctcgtcggcgaaggcctggtcaccgcaggtaaccccgcccaggcgtgccgggac
ctcgccgcagcgggaaaacacccagcctgcccccaaaagaattcctaa

DBGET integrated database retrieval system