KEGG   Corynebacterium jeikeium: jk0798Help
Entry
jk0798            CDS       T00255                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC 4.2.1.20).,The beta subunit is responsible for the synthesis of L-tryptophan from indole and L-serine. (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cjk  Corynebacterium jeikeium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    jk0798 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    jk0798 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    jk0798 (trpB)
Enzymes [BR:cjk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     jk0798 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
951210..952499
Genome map
AA seq 429 aa AA seqDB search
MTTEKTFKNADAQGKTLPTVGEILATATHHEPDERGHWGDFGGRYVPEALMAVIEEITDA
WAKARSDQGYLDQLDELHRTYTGRPSPLYYAARFSEAVGAEVWLKREDLNHTGSHKINNV
LGQVLLAKRMGKTRVIAETGAGQHGVATATACALLGIDCRIYMGAVDAERQALNIARMRL
LGAHVEVVEIGSRTLKDAINEAMRFWVSNADDTYYCFGTAAGPHPFPQMVRDLQRVIGVE
ARQQLLAETGKLPDAVVACVGGGSNAIGLFHPFIEDEGVDIVGAEAAGDGVETGRHAAPI
NLGLQGVFQGAFADLMQDEDGQIIESHSISAGLDYPGVGPEHSKLHAEGRARYLPITDSE
AMDGFKQLTLLEGIIPAIESSHAVAAAIKVAAEKPGSTLIVNISGRGDKDVNTAAKWFDM
LDQKSEKDG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgactaccgagaagaccttcaagaacgccgacgcgcaaggcaagaccctgccgacggta
ggcgagatcctggcgaccgccacccaccacgagcccgacgagcgcggacactggggtgat
ttcggtggccgctacgtccccgaggccctcatggccgtgatcgaggagatcaccgacgcc
tgggcgaaggcccgctcggaccaggggtacctggaccagctcgacgagctgcaccgcacc
tacaccggccgcccgtcgccgctgtactacgcggcccgcttctccgaggccgtgggcgca
gaggtgtggctgaagcgcgaggacctgaaccacaccggatctcacaagatcaacaacgtg
ctggggcaggtgctgctggccaagcgcatgggcaagactcgtgtgatcgcggagaccggc
gcaggccagcacggtgtggccacggcgacggcctgtgcgctgctcggcattgattgccgg
atctacatgggggccgtggacgccgaacggcaggccctcaacatcgctcgcatgcgcctg
ctcggtgcccacgtggaggtagtggagatcggctcccgcaccctgaaggacgccatcaac
gaggccatgcgcttctgggtttccaacgccgacgacacctactactgcttcggcaccgcc
gccggcccgcacccattcccgcagatggtgcgcgacctgcagcgcgtgatcggcgtggag
gcgcgccagcagctgctggccgaaaccggcaagctgcccgacgccgtagtggcctgcgtg
ggcggcggttccaacgcgatcggactgttccacccgttcatcgaggacgaaggcgtggac
atcgtcggcgctgaggccgcgggcgacggtgtagagaccggtcgccacgccgcgccgatc
aacctggggctgcagggcgtgttccagggggccttcgccgacctcatgcaggacgaggac
gggcagattatcgaatcgcactccatctccgccgggttggattacccgggcgtggggccg
gagcactctaagctgcacgctgaagggcgcgcccgctacctgccgatcaccgactccgag
gccatggatggcttcaagcagctgaccctcctggagggcatcatccccgccatcgagtcc
tcccacgcggtcgccgccgccattaaggtggccgcggagaagccgggatccacgctgatt
gtgaacatttccggccgcggcgacaaggacgtcaacacggctgcgaagtggttcgacatg
ctggatcagaagagcgagaaggacggctaa

DBGET integrated database retrieval system