KEGG   Corynebacterium jeikeium: jk0799Help
Entry
jk0799            CDS       T00255                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC 4.2.1.20).,The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate. (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cjk  Corynebacterium jeikeium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    jk0799 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    jk0799 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    jk0799 (trpA)
Enzymes [BR:cjk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     jk0799 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
952503..953273
Genome map
AA seq 256 aa AA seqDB search
MTSRLSKVFTDARAEGRAALVAYFPAGYPTVAKSKELVAELAQHADLIEVGIPFTDPMMD
GPTIQAAANEALDNGFRVKDTLDVVRAVTEAGGQAVIMSYWNPVLQYGPEKFAADLAAAG
GLGSIIPDLLPEEAGRWAEACKTNDLSPVYLVAPSTTPERMALTVDAGDGFIYAASHMGV
TGAQDEVSSSAEELVARVREATDLPVAVGLGVKTGKHAANIASYADGVIVGSALIQAAAD
GNLGELAAELARGVRA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacctcccgactttctaaggttttcaccgacgcgcgcgccgaggggcgagccgcactc
gtggcctacttcccggccggctaccccacggtggctaagtccaaggagctcgtcgccgag
ctagcccagcacgccgacctgatcgaggtgggtattccgttcaccgacccgatgatggac
ggccccaccatccaggccgccgccaacgaagctttggacaacggcttccgggtgaaggac
acactcgacgtcgtccgcgccgtcaccgaggcaggtggccaggccgtcatcatgtcctat
tggaaccccgtgctgcagtacggcccggagaagttcgccgcagacctggccgccgccggg
ggactgggctccatcatcccggacctgctgccggaggaagccggtcgttgggcggaggcc
tgcaagaccaatgacctatcgccggtctatctcgtcgcgccctccaccacgcccgagcgc
atggcccttactgttgacgccggcgacggcttcatctacgccgcatcccacatgggtgtg
acgggcgcgcaggacgaggtctccagttccgccgaggagctggtcgcccgcgttcgcgag
gccacggacctgccggtggcagtggggctgggcgtgaagaccggtaagcacgcggcgaac
atcgcctcctacgcagacggcgtgatcgtcggctccgcgctgatccaggccgcagccgac
ggcaacctgggcgagctggctgcagagctggcgcgaggcgttcgcgcatga

DBGET integrated database retrieval system