KEGG   Corynebacterium jeikeium: jk0999Help
Entry
jk0999            CDS       T00255                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cjk  Corynebacterium jeikeium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    jk0999 (tpiA)
   01230 Biosynthesis of amino acids
    jk0999 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jk0999 (tpiA)
   00051 Fructose and mannose metabolism
    jk0999 (tpiA)
   00562 Inositol phosphate metabolism
    jk0999 (tpiA)
Enzymes [BR:cjk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     jk0999 (tpiA)
Exosome [BR:cjk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   jk0999 (tpiA)
  Exosomal proteins of bladder cancer cells
   jk0999 (tpiA)
  Exosomal proteins of melanoma cells
   jk0999 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1182324..1183109)
Genome map
AA seq 261 aa AA seqDB search
MTARKPLIAGNWKMNLNHLEAMQVVQKFVFALPKEYYESVDVAFIPPFTDIRSVQTLVDG
DKLAITYGGQDVSQHASGAYTGEVSGAMLQKLGCTWAIVGHSERRQYHGETDEVVAAKAR
AALDNELQPIVCVGEQLDVREKGEHVDFVKEQTKASLAGLSAEDLAKTVIAYEPVWAIGT
GKVASAEDAQEVCHAIRELVAELAGEEVAGGIRILYGGSVKTDSVGELVSQPDVDGGLVG
GASLDGEDFARLAAAAAKATA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcaagccccttatcgccggcaactggaagatgaacctgaaccacctggag
gccatgcaggtcgtccagaagttcgtcttcgcactgccgaaggaatactacgagtccgtt
gacgtggccttcatcccgccgtttaccgacatccgctccgtgcagaccctggtcgacgga
gacaagctggccatcacctacggcggccaggatgtttcccagcacgcctccggcgcctac
accggtgaggtctccggcgcgatgctgcagaagcttggctgcacctgggccatcgtcggc
cactcggagcgccgccagtaccacggagagaccgacgaggtagtggccgccaaggcacgc
gccgcgctagacaacgagctgcagcccatcgtgtgcgtcggcgagcagctggacgtccgc
gaaaagggcgagcacgtagatttcgtcaaggagcagaccaaggcctccctggccggccta
tccgctgaggacctggctaagacggtcatcgcctacgagcctgtctgggccatcggcacc
ggcaaggttgcctccgccgaggacgcgcaggaggtctgccacgccattcgcgagctcgtc
gcagagctggcgggcgaggaggttgcaggtggaatccgcatcctctatggcggttccgtg
aagaccgattccgtcggagagctggtcagccagccggacgtcgacggtggtctggtcggc
ggggcgtcactagacggcgaagacttcgcccgcctggctgccgcagcagctaaggcaacc
gcctaa

DBGET integrated database retrieval system