KEGG   Corynebacterium jeikeium: jk1055Help
Entry
jk1055            CDS       T00255                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cjk  Corynebacterium jeikeium
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    jk1055 (ruvA)
Enzymes [BR:cjk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     jk1055 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1248702..1249337)
Genome map
AA seq 211 aa AA seqDB search
MIASLRGTVIDKGLDYVTIECAGVGYQCSGTATTIAELPRGEEVFVTTALVVREDSQTLY
VFKDADEKRAFATLQSVSGVGARLALAILSVITPQELARAVSNGDHKTLQRAPGVGKRLA
ERMAVDLKGKVADLGEIADTGAVGAAGAVGDGGDGQAVAPDVREQVLEALVGLGFTESKA
GTTIEAVLSQWSAPQAPDASGLLRASLAAIK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcatcgttgcgtggaaccgtaattgataaaggcctggactacgtgaccattgaa
tgcgcgggagtgggctaccagtgctccggtacggccaccaccatcgcggaactgccgcga
ggcgaggaagtcttcgtgacaaccgccttggttgtgcgtgaggactcacagactctgtac
gttttcaaggacgcagacgagaagcgcgctttcgctaccctgcaatctgtcagcggagtg
ggcgcccggctggcattagcgattctgtcggtgatcacccctcaggaacttgcccgagca
gtatctaacggcgaccataagaccctgcagagagcaccaggcgtgggcaagcgcctggcc
gaacgcatggccgtagatctaaagggcaaggtggcggatctgggggagatcgctgatacc
ggcgctgtgggagcggccggtgcagtcggcgatggcggcgatggtcaggccgtggctccg
gatgtgcgcgagcaagttctcgaggcgctcgtcgggctcggctttacggagtctaaggcc
ggcaccaccatcgaagcagtcctgtctcaatggtctgccccgcaagccccggacgcttcc
gggctgctgcgcgcatcgttggcggctattaaatag

DBGET integrated database retrieval system