KEGG   Corynebacterium jeikeium: jk1074Help
Entry
jk1074            CDS       T00255                                 

Gene name
hemG
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cjk  Corynebacterium jeikeium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    jk1074 (hemG)
Enzymes [BR:cjk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     jk1074 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1266122..1267567)
Genome map
AA seq 481 aa AA seqDB search
MKANQFSCHFEKLDTTGLEGLRVAIIGGGIAGLAAAWELRRQLGPGARILLTEAYDRLGG
KLKTVNYANGPVDMGAEAYMGFRQDFTELVESVGLGDQLCVPSGLPSGFYVDGALVDIPR
RTLMGIPSRGSDVVEVVGQDGAARIDAERNGQPMTWTPGQDTSVGQLVEARLGRIVVDRL
VSPLLGGVYSCNAFDLGVRATLPQLAAELDRRGAEGQPFFLVDAVEHLLSQRSTPKEREK
PKPVFRSLRGGYASLVDALVRHADPELLRNTAVESIGRTRGGYYIDPIGEFDAVIVATPA
PTASAILQYMAPTAADVLGDIDLASSVVVGMRMASAHGIPERSGVLLGSDAPTEAKAFTF
SSRKWPHLAERGGAFVRASFGSFGNPWHLDVDNRALLSFAVEDLERITGERKTPEEYFVQ
RWWGGLPRYGVGYMDAMSQAYNEVLEIRGLALAGSMLNGVGVPATAASGVEAAREIIREM
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctaaccagttttcttgccatttcgagaagctagataccaccgggctggaaggt
ctgcgtgtcgccattatcggcggtggtattgccggtctggctgcggcgtgggagctgcgt
cgccagttggggccgggcgcccgcatcttgctgactgaggcctatgaccggctgggcgga
aagctaaagacggtgaattatgccaacggtccggtggatatgggagcggaggcatacatg
ggtttccgccaggacttcactgaactggttgagtccgttgggctgggggaccaattgtgt
gtgccctctggccttccaagcggcttctatgtggacggcgcgctggtcgatataccgcgg
cgcacgttgatgggtattccttcccgtggttcggacgttgtcgaggtcgtggggcaagac
ggtgcggcgcggatcgacgcagagcgcaacgggcagccgatgacgtggacgccgggccag
gacacttctgtcgggcagctggtggaagcacgactggggcgtatcgtggtcgaccgtttg
gtatcgccactgctgggaggagtgtattcctgcaacgcttttgatctgggcgtgcgcgcc
acgcttccgcaactggcggcagagctggaccgccgcggcgcggagggccagccgttcttc
ctggtggatgctgtcgagcaccttctgtctcagcggtccacaccgaaggagagggagaag
ccgaagcccgtcttccgcagcctgcgcggagggtacgccagcctggtagatgcactggtc
cgccacgcagatccggaactgctgcgcaacaccgcagtggagtccatcggtcgcacccgg
ggcggctactacatcgatcctatcggtgagtttgatgccgtcatcgtcgccaccccggca
cccactgcctcggccatcctgcagtacatggctcccaccgccgcggatgtattgggggac
attgatcttgccagcagcgtagttgtcggcatgcgaatggcttccgcccatggcatcccc
gagcgttcgggtgttctcttgggtagtgacgcccccacggaggcgaaggccttcacattc
tcttctcgtaagtggccgcacctggccgaacgcgggggagcctttgtgcgggctagcttc
ggcagctttggcaacccgtggcacctggatgtagataatcgtgccctgctgagctttgct
gtcgaggacctcgagcgcatcaccggcgagcggaagaccccggaggagtatttcgtgcag
cgctggtggggtggcctgccgcgctatggcgtgggctacatggatgcaatgtctcaggca
tacaacgaggtgttggaaatccgcggactagcattggccggttcgatgctcaacggtgtg
ggcgttcccgcaaccgccgcgtcgggcgtggaggccgcacgggagattatccgcgagatg
gcgtga

DBGET integrated database retrieval system