KEGG   Corynebacterium jeikeium: jk1086Help
Entry
jk1086            CDS       T00255                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00010  Glycolysis / Gluconeogenesis
cjk00520  Amino sugar and nucleotide sugar metabolism
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
cjk01120  Microbial metabolism in diverse environments
cjk01130  Biosynthesis of antibiotics
cjk01200  Carbon metabolism
Module
cjk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jk1086 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    jk1086 (ppgK)
Enzymes [BR:cjk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     jk1086 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: CAI37250
UniProt: Q4JVA7
Position
1278462..1279091
Genome map
AA seq 209 aa AA seqDB search
MQWREVVRKLMDMAEWDGPVGVTVPAVVKDQKARSAANIDKSWIDTDMQELFKRHLGERE
IAVLNDADAAGLAEVKYGEESAKEGAVLMLTFGTGIGSAMLCDGNLFPNSELGHLPHDKN
GDVEWYASSAAKDREELSYKKWAARVDEVLHAYSALFSPKTFIVGGGISRKADKWVPLLT
VEEEVIPAKLRNQAGIIGAAMAVQDGIKP
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcgcgaggtcgtgcgcaagctgatggacatggccgaatgggatggcccggtg
ggtgtaacggtgcccgccgtagtcaaggaccagaaggctcgctccgcggcgaacatcgac
aagtcgtggatcgataccgatatgcaggagctgttcaagcgccacctcggcgagcgggag
atcgctgttcttaatgacgccgacgcagccggactggccgaggtcaagtacggcgaggaa
agcgcgaaggagggcgcggtgctgatgctcactttcggaaccggcatcggctccgccatg
ctgtgtgatggaaacctattccccaactccgagctgggccatctgccccacgataagaat
ggtgacgtcgaatggtatgccagctccgcagcgaaggatcgcgaggagctgtcatataag
aagtgggccgcgcgcgtggacgaggttctgcacgcctacagcgctctgttcagcccgaag
acgtttatcgtcggtggtggtatttcccgcaaggccgacaagtgggttccgctgttgacc
gtcgaagaggaagtcatcccggcgaagcttcgcaaccaggccggcattatcggtgctgca
atggccgtacaagacggcatcaaaccctag

DBGET integrated database retrieval system