KEGG   Corynebacterium jeikeium: jk1205Help
Entry
jk1205            CDS       T00255                                 

Gene name
mutM
Definition
(GenBank) Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23) (Fapy-DNA glycosylase).,This enzyme may play a significant role in processes leading to recovery from mutagenesis and/or cell death by alkylating agents. Also involved in the go system responsible for removing an oxidatively damaged form of guanine (78-dihydro-8-oxoguanine = 7-OxoG) from DNA. Can also nick DNA at apurinic/apyrimidinic sites (AP sites) (By similarity). (EC:3.2.2.23)
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cjk  Corynebacterium jeikeium
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    jk1205 (mutM)
Enzymes [BR:cjk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     jk1205 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     jk1205 (mutM)
DNA repair and recombination proteins [BR:cjk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     jk1205 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1420283..1421149)
Genome map
AA seq 288 aa AA seqDB search
MPELPEVEVVRRGLEEHLVGRRFTDVQVCHPRAVRSGEPEVLVSSLRDATVTAVKRRGKF
LWLDFGEDFLLQVHLGMSGQMLVAEPGQVQSPHVRIRAGLSDGRELCFVDQRTFGEWRLE
KAVPDPWAAGAGVASPKNFLPQNVSHIAADPLEAVFDAQAAVARMKSKRAAVKTVLLNQE
VVSGIGNIYADEALFLAGVRPRRSAALLSRPTLHRVLQSAAEVMECALEQGGTSFDSLYV
NVNGASGYFSRSLNVYGRGGEPCKRCGAPIKRVVVGGRSTHYCATCQR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaactcccagaggtagaggtcgtccgccgcggcctcgaagaacacctggtcggc
cgccgctttaccgacgttcaggtctgtcacccgcgcgccgtgcgatccggggaaccggag
gtgcttgtttcttctcttcgtgacgccaccgtcaccgcagttaaacgccgcggaaaattc
ttgtggttggatttcggcgaggacttcctgctgcaagtgcacctgggcatgagcggccag
atgctcgttgccgaacccggccaggtacaatccccgcatgtgcgcatccgagcggggcta
tccgatgggcgcgaactctgtttcgtagaccagcgaaccttcggcgagtggcggctggaa
aaggccgtgccggatccttgggcagcgggtgccggggtggcgtcaccaaaaaattttcta
ccccagaatgtcagccacattgctgccgatccgctagaggcggtcttcgacgcgcaggca
gcggtggcgcggatgaagtccaagcgcgcggcggtgaagacggtgctgctgaaccaggag
gttgtctccggtatcggcaacatctacgccgacgaggcactgtttctggcgggagtgcgc
ccgcggcgcagcgcggcactgttgagcaggcctactttgcaccgggtgttgcagtcagcg
gcggaggtgatggagtgcgccctggagcagggcggcaccagtttcgactcgctgtatgtg
aacgtcaacggtgcgtcggggtacttttcgcgctcgctgaacgtgtacgggcgcggcggt
gaaccctgtaagaggtgcggggcgccgatcaagcgagtggtcgtcggtgggcgatcgacg
cactactgcgcgacgtgtcagcggtag

DBGET integrated database retrieval system