KEGG   Corynebacterium jeikeium: jk1308Help
Entry
jk1308            CDS       T00255                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cjk  Corynebacterium jeikeium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    jk1308
   01230 Biosynthesis of amino acids
    jk1308
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jk1308
   00030 Pentose phosphate pathway
    jk1308
   00051 Fructose and mannose metabolism
    jk1308
   00052 Galactose metabolism
    jk1308
  Energy metabolism
   00680 Methane metabolism
    jk1308
Enzymes [BR:cjk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     jk1308
Protein phosphatases and associated proteins [BR:cjk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     jk1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1546990..1548018)
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTAAGEGHTVVGFEDGWQGLLEDRRVQLYDDDFIDRI
LRRGGTILGTGRLHPDDFMAGIDRVKANLEDAGIDALIPIGGEGTLKGARFLHDNGVPVI
GVPKTIDNDVNGTDYTFGFDTAVAVATDAIDRLHTTAESHDRVMIVEVMGRHVGWIALHA
GMAGGAHEILIPEFPFDIDDVCRRMARRFQLGEKYGIIVVAEGALPKEGTLDVAEREVDQ
FGHEKFQDMSALIAKEIENRLDTDVRSTVLGHIQRGGTPTAFDRVLATRFAVNATKAAIR
GDFGKVVALKGGSIELIDFEEAVGTLKEVPEKRYETARSLFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgcgaccttgaccagtggtggagactgcccaggattgaacgccgttatccga
ggcatcgtgaggacagcggccggggaaggccataccgtcgtcggattcgaagatggttgg
caggggctgctggaagaccgtcgtgtgcaactgtatgacgacgactttatcgaccggatc
ctgcgccgcggaggcaccatcctcggtaccggacgcctgcaccccgacgacttcatggcc
ggcatcgaccgcgtcaaagccaaccttgaggatgcaggtatcgatgcgttgatccccatc
ggcggcgaaggcactctgaaaggcgcgcgcttcctgcacgacaacggcgtgccagtaatc
ggcgtgccgaaaaccattgacaatgacgtcaacggaaccgactacaccttcggctttgac
accgccgtcgccgtcgctaccgatgcaatcgatcgactgcacaccaccgccgaatcacac
gaccgcgtgatgatcgtggaggtcatggggcgccacgtcggctggatcgcgctgcacgcg
ggcatggccggtggcgcgcacgagattctgattccggagttccccttcgacatcgatgac
gtctgccgccgcatggctcgtcgattccagctgggggagaagtacggcatcattgtcgta
gccgaaggcgcactgccaaaggaaggaactctggacgtcgcagaacgcgaggtggaccag
ttcggccacgagaagttccaagacatgtccgcgctgatcgccaaggagatcgaaaaccgc
ctggatactgacgtgcgctccaccgtgctggggcacatccagcgcggcggaacccccacc
gcgttcgaccgcgttctggcaacccgctttgccgtgaatgctaccaaggccgccattcgg
ggagatttcggcaaggtggttgcgctgaagggcggcagcatcgagctgatcgactttgag
gaggccgtcggcacgctgaaggaagttcccgagaagcgctacgaaacggcacgctcgctg
ttcggctag

DBGET integrated database retrieval system