KEGG   Corynebacterium jeikeium: jk1308Help
Entry
jk1308            CDS       T00255                                 

Definition
(GenBank) unnamed protein product; Region start changed from 1547952 to 1548018 (66 bases)
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cjk  Corynebacterium jeikeium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    jk1308
   00030 Pentose phosphate pathway
    jk1308
   00051 Fructose and mannose metabolism
    jk1308
   00052 Galactose metabolism
    jk1308
  Energy metabolism
   00680 Methane metabolism
    jk1308
Enzymes [BR:cjk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     jk1308
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     jk1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1546990..1548018)
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTAAGEGHTVVGFEDGWQGLLEDRRVQLYDDDFIDRI
LRRGGTILGTGRLHPDDFMAGIDRVKANLEDAGIDALIPIGGEGTLKGARFLHDNGVPVI
GVPKTIDNDVNGTDYTFGFDTAVAVATDAIDRLHTTAESHDRVMIVEVMGRHVGWIALHA
GMAGGAHEILIPEFPFDIDDVCRRMARRFQLGEKYGIIVVAEGALPKEGTLDVAEREVDQ
FGHEKFQDMSALIAKEIENRLDTDVRSTVLGHIQRGGTPTAFDRVLATRFAVNATKAAIR
GDFGKVVALKGGSIELIDFEEAVGTLKEVPEKRYETARSLFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgcgaccttgaccagtggtggagactgcccaggattgaacgccgttatccga
ggcatcgtgaggacagcggccggggaaggccataccgtcgtcggattcgaagatggttgg
caggggctgctggaagaccgtcgtgtgcaactgtatgacgacgactttatcgaccggatc
ctgcgccgcggaggcaccatcctcggtaccggacgcctgcaccccgacgacttcatggcc
ggcatcgaccgcgtcaaagccaaccttgaggatgcaggtatcgatgcgttgatccccatc
ggcggcgaaggcactctgaaaggcgcgcgcttcctgcacgacaacggcgtgccagtaatc
ggcgtgccgaaaaccattgacaatgacgtcaacggaaccgactacaccttcggctttgac
accgccgtcgccgtcgctaccgatgcaatcgatcgactgcacaccaccgccgaatcacac
gaccgcgtgatgatcgtggaggtcatggggcgccacgtcggctggatcgcgctgcacgcg
ggcatggccggtggcgcgcacgagattctgattccggagttccccttcgacatcgatgac
gtctgccgccgcatggctcgtcgattccagctgggggagaagtacggcatcattgtcgta
gccgaaggcgcactgccaaaggaaggaactctggacgtcgcagaacgcgaggtggaccag
ttcggccacgagaagttccaagacatgtccgcgctgatcgccaaggagatcgaaaaccgc
ctggatactgacgtgcgctccaccgtgctggggcacatccagcgcggcggaacccccacc
gcgttcgaccgcgttctggcaacccgctttgccgtgaatgctaccaaggccgccattcgg
ggagatttcggcaaggtggttgcgctgaagggcggcagcatcgagctgatcgactttgag
gaggccgtcggcacgctgaaggaagttcccgagaagcgctacgaaacggcacgctcgctg
ttcggctag

DBGET integrated database retrieval system