KEGG   Corynebacterium jeikeium: jk1330Help
Entry
jk1330            CDS       T00255                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cjk  Corynebacterium jeikeium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    jk1330 (glgB)
Enzymes [BR:cjk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     jk1330 (glgB)
Exosome [BR:cjk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   jk1330 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1575052..1577187
Genome map
AA seq 711 aa AA seqDB search
MNHDYHRLAERRHHAPHDVLGAHENGDGTTTIRTVQCGAESVAVRINGGEPVQMVPAEEY
PALFTATVDYFVDTYNFEVTWAGGTAATLEDPYRRLPTVGDLDRYLIGEGRHEELWKVLG
AHVVDGGVAFSVWAPHAAGVSVIGDFNGWNANQHPLRALGSSGIWELWIPSVSAGAHYKF
SITTGDGVRLDKADPMARLAEPAPATASIVVADSDYAWGDDEWLAHRAAVGVDETMSIYE
MHLGSWRKGRSYRELAVELVEYVQELGYTHVELMGVSEHPFEPSWGYQVTSYYAPNNRYG
GPDDLRYLIDSLHRAGIGVIMDWVPGHFPKDGWALGRFDGEACYEHPDPRRGEQPDWGTY
VFDFGRNEVRNFLVANALYWCKEFHIDGLRVDAVASMLYLDYSRDDWLPNQYGGRENLDA
VEFLKEMNATVHRECPGSLTIAEESTSWPGVTAPTSEGGLGFSLKWNMGWMHDSLEYIQR
DPAYRSYHHNEITFSMVYAYSENYVLPISHDEVVHGKGTLWSRMPAGSAWDKAAMVRSYL
AFMWAHPGKKLLFQGQEWGQTEEWNESRGLDWHDLEGWEGEFHRGISALTSQLNKLYHSE
LALGQDHAPEGFQWIASDDSTNNVLSFIRRHRGRELACVINFSGTTQENYRIGLPQAGTW
REVLNTDDVQYEGAGRVNGDLHTEPTGSHGMEASAVLQIPAHTARWFVLES
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgattaccaccggctcgcagaacgtaggcaccacgccccgcacgacgtgctt
ggggcacacgagaacggcgacggaaccaccaccatccgcactgtccagtgcggggcagaa
tccgtagctgtgcgcatcaacggtggcgagccggtgcagatggtgccggcagaggaatac
ccggcgctgttcaccgcaactgtggattatttcgtggacacctacaatttcgaggtcacc
tgggccggcggcaccgccgccaccctggaagacccctaccggcgcctgcctaccgtcggt
gacctggaccgctacctcatcggcgagggccggcacgaggagctgtggaaggtcctcggc
gcgcacgtcgtggatggtggagtggccttttccgtgtgggcaccgcatgccgcaggcgtt
tccgtgatcggcgacttcaacggctggaatgctaaccagcaccccttgcgcgcgctgggt
agcagcggcatctgggagctgtggatcccgagtgtgagtgccggggcgcattacaagttc
tccatcaccaccggtgatggcgtacgcctggacaaagccgacccgatggcacgcctggcc
gagcccgcccccgcgactgcctccatcgtcgtagcggacagcgactatgcctggggtgac
gacgagtggctggcccaccgcgctgctgtgggggtggacgagaccatgagcatctacgaa
atgcacctaggcagctggcgcaaggggcgcagctaccgggagctggccgtggagctggtg
gaatatgtgcaggagctgggctacacccacgtggagctgatgggtgtgtccgagcaccca
ttcgagccttcctgggggtaccaggtgaccagctactacgcaccgaacaaccgctacggt
ggcccggatgacctgcgctacttgatcgattcgctgcaccgcgccggcatcggcgtgatt
atggactgggttcccggccacttccccaaggacggctgggccctgggccgcttcgacggc
gaggcctgctacgaacacccggatccgcgccgcggcgagcagccggactggggcacctat
gtgttcgacttcggccgcaacgaggtgcgcaacttcctggtggccaacgctttgtactgg
tgcaaggagttccacatcgacggtctgcgcgtggatgccgtggcctcgatgctgtacctg
gactactcccgtgacgactggctgcccaaccaatacggcgggcgcgagaacctggatgcg
gtggaattcctcaaagaaatgaacgccaccgtgcaccgcgaatgcccgggttcgctgact
attgccgaagagtcgacctcctggccgggagtgaccgcccccaccagcgaaggcggcctg
gggttcagcctgaagtggaacatgggctggatgcacgacagcctggagtacatccagcga
gatcctgcctaccgcagctaccaccacaacgagatcactttctcgatggtctacgcctac
tccgagaactacgtccttccaatcagccacgacgaggtagtgcacggcaagggcaccctg
tggtcgcgcatgcccgccggttccgcctgggacaaggctgcgatggtgcgcagctacctg
gcgttcatgtgggcgcacccgggcaagaagttgctcttccagggccaggaatggggccag
accgaggagtggaatgagtcccgcggtctggattggcacgacctcgaaggctgggagggc
gagttccaccgcggcatcagcgccctgaccagccagctgaacaagctctaccactccgag
ctcgctctggggcaggatcacgcgccggagggcttccagtggatcgccagcgacgactcg
acgaataacgttctttcctttattcgacgccaccgtgggcgcgagctggcgtgtgttatt
aacttctcgggcaccacccaagagaactaccgcatcggcctgccgcaggccggcacgtgg
cgcgaggtgttgaacaccgacgacgtgcagtacgagggcgccgggcgcgtgaacggcgac
ctgcacacggagcccaccggctcccacggtatggaggcctccgccgtgctgcagatcccg
gcgcacaccgcgcgctggttcgtactggagagttaa

DBGET integrated database retrieval system