KEGG   Corynebacterium jeikeium: jk1351Help
Entry
jk1351            CDS       T00255                                 

Gene name
thrC
Definition
(GenBank) thrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00260  Glycine, serine and threonine metabolism
cjk00750  Vitamin B6 metabolism
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
cjk01120  Microbial metabolism in diverse environments
cjk01230  Biosynthesis of amino acids
Module
cjk_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    jk1351 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    jk1351 (thrC)
Enzymes [BR:cjk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     jk1351 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAI37523
UniProt: Q4JUI4
Position
complement(1597099..1598172)
Genome map
AA seq 357 aa AA seqDB search
MTNKVLNHWTGLINMYRDRMPFAKDWEPVTLNEGGTPLLRANYLSEITGCDVYLKIEGAN
PTGSFKDRGMTVAVTDAYHKGQKVLMCASTGNTSASAAAYAARAGLKSAVLIPEGKIAQG
KLAQAVMHGAQIIQVRGNFDDCLELVRKTTTEFPEIALVNSVNPMRIEGQKTAAFEIVDC
LGDAPDVHFLPVGNAGNITAYWKGYSEYAEDGVSTQRPVMKGVQAAGAAPLVKGEPVLEP
ETIATAIRIGNPASWQQAVAAKEESGGDFRAQTDEQILEAYRTIAGREGIFVEPASASSV
AGLLDAHANGELTAGQRIVCTVTGHGLKDPTTALSQMPEPTVTDVDPHAVADKLGLK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaaggttctgaaccactggaccggcctgatcaacatgtaccgcgatcggatg
ccgttcgcgaaggactgggagccggtgaccctcaacgagggcggcactccgttgctacgc
gcgaactacctgtcggagatcaccggctgcgatgtttacctcaagatcgagggcgccaac
cccaccggttccttcaaggatcgcggcatgaccgttgccgtcaccgacgcttaccacaag
ggccagaaggttctgatgtgcgcctcgactggcaacacctcggcttccgccgctgcctac
gcagctcgcgccggtctgaagtccgccgtgctgatcccagagggcaagatcgcccagggc
aagctcgcacaggctgtcatgcacggtgcacagatcatccaggtccgcggcaactttgac
gactgcctcgagctggtgcgcaagaccactaccgagttcccggagatcgccctggttaac
tcagtgaacccaatgcgcattgaggggcaaaagaccgccgcgtttgagattgtggattgt
cttggtgacgcccccgacgttcacttcctgccagtcggcaacgcgggcaacatcacggcg
tattggaagggctactccgagtacgcagaagatggcgtttccacccagcgtcccgtgatg
aagggtgtgcaggcagcaggcgctgctccactggtcaaaggcgagcccgtgctggagccg
gagacgatcgccaccgcgatccgcatcggtaacccggcttcttggcagcaggcagttgcc
gccaaggaggagtcgggtggcgacttccgcgctcagaccgacgagcagatcctggaggcc
taccgcaccatcgcaggacgtgagggcatctttgttgagccggcatctgcgtcttccgtt
gcgggcctgctggatgctcatgccaacggcgagttgaccgcaggacagcgcattgtgtgc
accgttaccggccacggcttgaaggacccgacgaccgctctgtctcagatgccggagccc
accgtcacggacgtggatccgcacgccgttgcagacaagctgggtttgaagtaa

DBGET integrated database retrieval system