KEGG   Corynebacterium jeikeium: jk1351Help
Entry
jk1351            CDS       T00255                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cjk  Corynebacterium jeikeium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    jk1351 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    jk1351 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    jk1351 (thrC)
Enzymes [BR:cjk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     jk1351 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1597099..1598172)
Genome map
AA seq 357 aa AA seqDB search
MTNKVLNHWTGLINMYRDRMPFAKDWEPVTLNEGGTPLLRANYLSEITGCDVYLKIEGAN
PTGSFKDRGMTVAVTDAYHKGQKVLMCASTGNTSASAAAYAARAGLKSAVLIPEGKIAQG
KLAQAVMHGAQIIQVRGNFDDCLELVRKTTTEFPEIALVNSVNPMRIEGQKTAAFEIVDC
LGDAPDVHFLPVGNAGNITAYWKGYSEYAEDGVSTQRPVMKGVQAAGAAPLVKGEPVLEP
ETIATAIRIGNPASWQQAVAAKEESGGDFRAQTDEQILEAYRTIAGREGIFVEPASASSV
AGLLDAHANGELTAGQRIVCTVTGHGLKDPTTALSQMPEPTVTDVDPHAVADKLGLK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaaggttctgaaccactggaccggcctgatcaacatgtaccgcgatcggatg
ccgttcgcgaaggactgggagccggtgaccctcaacgagggcggcactccgttgctacgc
gcgaactacctgtcggagatcaccggctgcgatgtttacctcaagatcgagggcgccaac
cccaccggttccttcaaggatcgcggcatgaccgttgccgtcaccgacgcttaccacaag
ggccagaaggttctgatgtgcgcctcgactggcaacacctcggcttccgccgctgcctac
gcagctcgcgccggtctgaagtccgccgtgctgatcccagagggcaagatcgcccagggc
aagctcgcacaggctgtcatgcacggtgcacagatcatccaggtccgcggcaactttgac
gactgcctcgagctggtgcgcaagaccactaccgagttcccggagatcgccctggttaac
tcagtgaacccaatgcgcattgaggggcaaaagaccgccgcgtttgagattgtggattgt
cttggtgacgcccccgacgttcacttcctgccagtcggcaacgcgggcaacatcacggcg
tattggaagggctactccgagtacgcagaagatggcgtttccacccagcgtcccgtgatg
aagggtgtgcaggcagcaggcgctgctccactggtcaaaggcgagcccgtgctggagccg
gagacgatcgccaccgcgatccgcatcggtaacccggcttcttggcagcaggcagttgcc
gccaaggaggagtcgggtggcgacttccgcgctcagaccgacgagcagatcctggaggcc
taccgcaccatcgcaggacgtgagggcatctttgttgagccggcatctgcgtcttccgtt
gcgggcctgctggatgctcatgccaacggcgagttgaccgcaggacagcgcattgtgtgc
accgttaccggccacggcttgaaggacccgacgaccgctctgtctcagatgccggagccc
accgtcacggacgtggatccgcacgccgttgcagacaagctgggtttgaagtaa

DBGET integrated database retrieval system