KEGG   Corynebacterium jeikeium: jk1525Help
Entry
jk1525            CDS       T00255                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00040  Pentose and glucuronate interconversions
cjk00052  Galactose metabolism
cjk00500  Starch and sucrose metabolism
cjk00520  Amino sugar and nucleotide sugar metabolism
cjk01100  Metabolic pathways
cjk01130  Biosynthesis of antibiotics
Module
cjk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    jk1525 (galU)
   00052 Galactose metabolism
    jk1525 (galU)
   00500 Starch and sucrose metabolism
    jk1525 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    jk1525 (galU)
Enzymes [BR:cjk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     jk1525 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAI37698
UniProt: Q4JU09
Position
complement(1799835..1800830)
Genome map
AA seq 331 aa AA seqDB search
MQKKTLLKWCVEHETQSLKRYYSGMTSSPTISTSEQAALRTVVVPAAGLGTRFLPATKTV
PKELLPVVDTPGIELIAKEAADAGADRLAIVTAPKKGGVLGHFDTDEELERTLEQRNKTD
QLNKVRATDGLIDVVAVEQEKPLGLGHAIGLAEQVLDEDEDCFAVMLPDDLVLPMGVMEK
MLAVRKQYGGSVLCAFEVPREETSNYGVFEIDEADHADVKIVKGMVEKPAVEDAPSNFVA
TGRYLLDRQVFDALRRTKPGKGGEIQITDAIELMITEGHPVHIIVHHGLRHDLGNPGGYI
RACVDFALQNETYGPSLKTWLRERLDQENEN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaagaaaactctccttaagtggtgtgtagagcacgaaacccagagcttaaagcgc
tactattccggcatgacttctagccctacgatctccacgtccgagcaagccgcactgcgt
accgtcgtggtcccggctgccgggctcggaacccgcttcctgccagccaccaaaactgtc
ccgaaagagttgctgcccgtcgtagacactcccgggatcgaactgatcgcgaaggaagcc
gctgacgcgggtgcagaccgcttggccatcgtgacggctccgaagaagggtggggtgctc
ggccactttgataccgatgaagagctggaacgcacacttgaacagcgcaataagaccgac
cagctaaacaaggtgcgcgctaccgacggcctgatcgacgtagtggctgtcgagcaggag
aagccgcttggactggggcacgccattgggctggccgagcaggtgctagatgaagacgaa
gactgcttcgccgtcatgctgccggatgatctggtgctgcctatgggcgtgatggagaag
atgcttgctgtgcgcaagcagtatggcggatccgtgctgtgtgccttcgaagtgccgcgg
gaggagaccagcaactacggagttttcgagatcgacgaggcggaccacgccgatgtgaag
atcgttaagggcatggttgaaaagcctgccgtagaagatgctccgtccaacttcgtggcc
accggacgctacctgctagaccggcaggtattcgatgcactgcgccgcacgaagcccggc
aagggtggggaaatccagatcaccgatgccatcgagctgatgatcaccgaaggccacccc
gtgcacatcattgtccaccacggtctgcgccatgacttgggaaacccgggtgggtacatt
cgggcttgtgtcgatttcgctctccagaatgagacatatggccccagcctgaaaacctgg
ctgcgcgagcgcctcgatcaggaaaacgaaaactag

DBGET integrated database retrieval system