KEGG   Corynebacterium jeikeium: jk1932Help
Entry
jk1932            CDS       T00255                                 

Gene name
aceB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cjk  Corynebacterium jeikeium
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    jk1932 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    jk1932 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    jk1932 (aceB)
Enzymes [BR:cjk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     jk1932 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2249903..2252098)
Genome map
AA seq 731 aa AA seqDB search
MTQTERVTAGGLQVAKTLYDFVNTEVLPAIGKDSAEEQEKFWDGFGKIVEEYTPRNRELL
NTRDELQKKMDAWYEDHKGAQDPEEYKAFLKEIGYLVDEPGDFEITTQNIDPEVGTTGGP
QLVVPILNARFALNAANARWGSLYDALYGTDAISEDNGQEKGTGYNKVRGDKVIEWGREF
LDRVVPLESGSHKDVTKYAVESGQLTATIDGNDVHLRNPEVYAGFGGDKANPTDILLYNN
GLYIDIQIDPESPIGKTDKAGVKDLNLESAISTIMDFEDSVAAVDATDKTLGYRNWLGLN
TGNLTEEVEKGGKTFTRKLNEDRVFTSRDGQELRLHGRSLLFVRNVGHLMQNPAILDQNG
EEIFEGIMDAVITSAAAIPGLDENNPLRNSRNGSIYIVKPKQHGPEEVAFTNDLFGAVED
LLGLERFTLKVGVMDEERRTTANLDACIAEVKERLAFINTGFLDRTGDEIHTSMLAGPMV
RKADLQTAPWKLAYEDNNVDAGLAHGLPGKSQIGKGMWAKTELMADMLEQKIGQPKEGAS
TAWVPSPTGATLHATHYHEVDVFEVQDKLRTEGRRETLGDILTVPVAESADWSAEEIAEE
IDNNSQSILGYVVRWVEQGVGCSKIPDIHDIDLMEDRATCRINSQHLANWLKHGVVTEEQ
VLESLQRMAAKVDEQNAGDANYRNMAPNFDESVAFQAAKDLVFKGLEQPAGYTEPILHAR
RLEFKAKNGIA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccgagcgcgtaactgccggcggccttcaggttgccaagactctctacgac
tttgttaacactgaggtacttcccgccatcggcaaggattccgccgaggagcaggagaag
ttctgggatggcttcggcaagatcgtcgaggagtacaccccgcgcaaccgcgagctgctg
aacactcgcgacgagctgcagaagaagatggatgcctggtacgaagaccacaagggtgct
caggatccggaggagtacaaggctttcctgaaggagatcggctacctggtcgacgagcca
ggcgacttcgagattacgacccagaacatcgacccggaggtcggcacgaccggcggcccg
cagctggtggtgccgatcctgaacgcccgcttcgcgctgaacgcggcgaacgcccgctgg
ggttccctgtacgatgccctctacggcaccgacgccatctctgaggacaacggccaggag
aagggcaccggctacaacaaggttcgcggcgacaaggtcatcgagtggggtcgcgagttc
ctggaccgcgttgtaccgctggagtccggctcccacaaggacgtcaccaagtacgccgtt
gagtccggccagctgaccgccaccatcgacggcaacgacgtgcacctgcgcaacccggag
gtctacgcaggcttcggcggcgacaaggccaacccgaccgacattctgctgtacaacaat
gggctgtacatcgacattcagatcgacccggagtccccgatcggcaagaccgacaaggct
ggcgtgaaggacctgaacctcgagtccgcaatctccaccatcatggacttcgaggactcc
gtcgccgctgtcgacgcaaccgacaagaccctgggctaccgcaactggctgggtctgaac
accggcaacctcactgaggaagtggagaagggtggcaagaccttcactcgtaagctgaac
gaggatcgtgtgtttacctcccgcgatggtcaggagctgcgtctgcacggtcgttccctg
ctgttcgtgcgtaacgttggccacttgatgcagaacccggcgatcctggatcagaacggt
gaggagatctttgagggcatcatggatgccgttattacttcggctgctgcgatcccgggt
ctggatgagaacaacccgctgcgtaactcccgtaacggttcgatctacattgtgaagccg
aagcagcacggcccggaggaggttgcgttcactaacgacctgttcggtgctgtggaggat
ctgctgggtctggagaggttcaccctgaaggtcggtgtgatggacgaggagcgtcgtacc
accgccaacctggatgcttgcatcgccgaggttaaggagcgtctggcgtttattaacact
ggcttcctggatcgcactggtgatgagatccacacctccatgctggctggtccgatggtg
cgtaaggcggatttgcagaccgcgccgtggaagctggcttacgaggacaacaatgtggat
gctggcctggcgcacggtctgccgggtaagtcgcagatcggtaagggcatgtgggccaag
actgagctgatggcggacatgctggagcagaagattggccagccgaaggagggcgcgtct
accgcgtgggttccgtccccgacgggtgcaacactgcacgcaacccactaccacgaggtg
gatgtctttgaggtgcaggacaagctgcgtaccgagggtcgtcgtgagacgctgggtgac
attctgaccgttccggtggcggagtctgctgattggtctgctgaggagatcgccgaggag
attgacaacaattcccagtccatcctgggttatgtggttcgctgggtggagcagggtgtg
ggttgctccaagattccggatatccacgacatcgatctgatggaggatcgcgctacctgc
cgtattaactcgcagcacttggctaactggctgaagcacggtgtggtgactgaggagcag
gttctggagtctttgcagcgtatggctgcgaaggtggatgagcagaacgctggtgatgcg
aactaccgcaacatggctccgaactttgatgagtcggtggctttccaggctgctaaggat
ttggtgtttaagggtctggagcagccggctggttacactgagccgatcctgcatgcccgt
cgtttggagttcaaggctaaaaacggcatcgcctaa

DBGET integrated database retrieval system