KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0067Help
Entry
CJM1_0067         CDS       T01855                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CJM1_0067 (folK)
Enzymes [BR:cjm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CJM1_0067 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(83304..83777)
Genome map
AA seq 157 aa AA seqDB search
MLKIQGVKHFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRFDMLFRVMMDDKRFKI
LSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYEVKFKRKRTFKNAPRTL
DLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPLGMI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaattcaaggagtaaaacactttgaaaaaagtcgtttttttcctttttttagt
caaaatatacgatcttttaaatatttagctcttataggcttaggaagcaatatagagccc
gaaaaaaaaagatttgatatgctttttcgagtaatgatggatgataaaagatttaaaatt
ttatccacatctcctatgttgataaatgaagcctttggttttaaagagcaaaaagatttt
accaatgctgttatgttgatacaaactaatttgcatgcacgagcacttttgaaagtttta
ctttattatgaagtaaaatttaaacgcaagagaactttcaaaaacgctcctagaacgctt
gatttagatcttttatacttttcacaaaaagtcaagcgtgataagtggtgtgaggtgcct
cataaaggggctaaagaaagagtgagtgtaattttgcctttaggcatgatataa

DBGET integrated database retrieval system