KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0067Help
Entry
CJM1_0067         CDS       T01855                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(83304..83777)
Genome map
AA seq 157 aa AA seqDB search
MLKIQGVKHFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRFDMLFRVMMDDKRFKI
LSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYEVKFKRKRTFKNAPRTL
DLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPLGMI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaattcaaggagtaaaacactttgaaaaaagtcgtttttttcctttttttagt
caaaatatacgatcttttaaatatttagctcttataggcttaggaagcaatatagagccc
gaaaaaaaaagatttgatatgctttttcgagtaatgatggatgataaaagatttaaaatt
ttatccacatctcctatgttgataaatgaagcctttggttttaaagagcaaaaagatttt
accaatgctgttatgttgatacaaactaatttgcatgcacgagcacttttgaaagtttta
ctttattatgaagtaaaatttaaacgcaagagaactttcaaaaacgctcctagaacgctt
gatttagatcttttatacttttcacaaaaagtcaagcgtgataagtggtgtgaggtgcct
cataaaggggctaaagaaagagtgagtgtaattttgcctttaggcatgatataa

DBGET integrated database retrieval system