KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0188Help
Entry
CJM1_0188         CDS       T01855                                 

Gene name
folE
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191091..191663
Genome map
AA seq 190 aa AA seqDB search
MQKKFEDCVKTILEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILNDALFESSN
NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLT
EQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFFS
LINSAKQVRF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaaaatttgaagattgtgttaaaaccatacttgaaattataggagaaaatcca
aatcgtgaaggactgattaaaacaccaaatcgtgtttttaaagcttatgaatttcttact
agtggttatacacaaaatgtcaaagaaattttaaatgacgctttatttgaaagctctaat
aatgaaatggttttagtgcgtgatatagaattttatagtctttgcgaacatcatctttta
cctttttttgggcgtgctcatgtagcctatattcctaataaaaaagtagtgggtttaagc
aaaattccacgccttgtagaggtgtttgcaagaagacttcaaattcaagaacaacttacc
gaacaaatcgcacaagctttaatggaaaatgtcgatgccaaaggtgttggcgtagtcata
gaagcaagacatatgtgtgttgaaatgcgtggagtacaaaaagctaattccaccactaca
acttcagctttgcgtggaattttcttaaaaaatgaaaaaactagagaagaatttttttct
ctcataaactctgctaaacaggtaagattttaa

DBGET integrated database retrieval system