KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0327Help
Entry
CJM1_0327         CDS       T01855                                 

Gene name
tsb1
Definition
Tryptophan synthase beta chain 1
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cjm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cjm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cjm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318749..319927
Genome map
AA seq 392 aa AA seqDB search
MKKAYYGDFGGQFLPESAMFALNELEGAFLKFSKDKLFKKELNELLKTYVGRPTPLYFAR
NLSKKYQHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATATAA
ALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLKTLKEATTAAIQAWVGDIKN
IFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKLNKKVDYIIAAVGGGSNAAGIFYDF
IKDENVKLIGIEAGGLGIDTPYHAATLNKGKTGIIHGMKTKVLQDDLGNILPVHSVSAGL
DYPGIGPLHAFLFESKRAQYHAISDEECMQALKLLCKEEGIIAAIESSHALAFLEKLCPT
LKKKSVIVVNLSGRGDKDMQMIRDYKKGVIYG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgtattatggggattttggtgggcagtttttgcctgaaagtgcaatgttt
gctttaaatgagctagaaggtgcttttttgaaattttctaaagataaactctttaaaaaa
gaattaaacgagcttttaaaaacttatgtagggcgtcctactccactttattttgctaga
aatttaagcaaaaaatatcagcatgaaatttatttaaaacgcgaggatttaaatcatacc
ggagcacataaaatcaataatgccatcgctcaagcccttttagcaaaaaaaatgggaaag
aaaaaaatcatagcagaaacaggagcaggtcaacacgggcttgcaacagccactgcagca
gcacttttaggacttgaatgtgaaatttatatgggggcaaccgatgtgcaaagacaggct
ttaaatgtttataaaatggagcttttgggtgctaaaattcatgcagtacaaagtgggctt
aaaactctaaaagaagctactactgcggctattcaagcttgggttggagatattaaaaat
attttttatgtggttggaagtgcggtaggtccttatccttatcctaaaatggtaatgcat
tttcaaagtattataggaaaagaatgcaaaatgcaacttcaaaaactcaataaaaaagta
gattatattatcgcagctgttgggggtggaagcaatgcagctgggattttttatgatttt
atcaaagatgaaaatgttaaacttataggtattgaagcaggggggcttggcattgatacg
ccttatcatgcagcgactttaaataagggaaaaacaggcattattcacggtatgaaaacc
aaggttttacaagatgatttaggcaatatcttgcctgtacatagtgtttctgcagggctt
gattatccaggaattggtcctttacatgcttttttatttgaaagcaaaagagcgcaatat
catgctataagtgatgaagaatgtatgcaggctttaaaattactttgtaaagaagaaggt
attattgcagcgattgaaagttcgcatgctttggcatttttagaaaaactttgtccaact
ttaaaaaagaaaagcgtgatagtagtaaatctttcaggcaggggagataaagatatgcaa
atgattagagattataaaaaaggggtgatttatggttga

DBGET integrated database retrieval system