KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0337Help
Entry
CJM1_0337         CDS       T01855                                 

Gene name
ccpA-2
Definition
Putative cytochrome C551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Brite
Enzymes [BR:cjm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CJM1_0337 (ccpA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325943..326968
Genome map
AA seq 341 aa AA seqDB search
MKVKSLLIASLVAFSSLNAASLIDEAKNSGLVALPKDQKGVDEILKQNGVKASEFTLEKA
ELGKKLYFEPRLSKSGIISCNTCHNVGLGGTDGISTAIGHKWTANPHHLNSPTVYNAVLN
NTQFWDGRAGTLADQAKGPIQADPEMATPAKLAVEKISSLPEYVSEFKKIYGKSGVNFDN
IADAIANFERTLITPSRFDKFLEGDEKALTKEEQKGLKLFIDKGCVACHNGVNLGGNMQA
FEVAGKYKFANLGDFKGDANGMVKTPTLRNVAETAPYFHNGAIWNLKDAIKEMGSVQLGI
KISDKEAKSIETFLKSLTGTKPAIVYPQLPISTEKTPKPEL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaatcattgctaatcgcatccttagttgctttttcaagcttaaatgctgca
agtcttatagatgaagctaaaaattcaggtcttgttgccttaccaaaagatcaaaaaggc
gttgatgaaattttaaaacaaaatggagtaaaggctagtgaatttactcttgaaaaagca
gagcttggcaaaaagctctattttgaaccacgtctttcaaaaagtggtatcatttcttgt
aatacctgtcataatgtaggacttggtggaacagatggaatcagtactgcaataggtcat
aaatggacagcaaatcctcatcatttaaattcaccaacagtttataatgcagttttaaat
aatactcaattttgggatggtcgtgcaggaacattagccgatcaagctaaaggtccaatc
caagctgatcctgaaatggcaactcctgctaaacttgcagtagaaaaaatttcatctttg
cctgaatatgtgagtgagtttaaaaaaatctatggtaaaagcggtgtaaattttgacaat
attgctgatgcaattgcaaattttgaaagaactttgatcactccatctcgttttgataaa
tttttagaaggcgatgaaaaagctttaacaaaagaagaacaaaaaggcttaaagcttttt
atagataaaggttgtgtagcttgtcataatggtgtgaatttaggtggcaatatgcaagcg
tttgaagttgctggtaaatataaatttgcaaatttaggtgattttaaaggtgatgcaaat
ggcatggtaaaaactccaactttaagaaatgttgctgaaactgctccatattttcataat
ggtgcgatttggaatttaaaagatgctattaaggaaatgggtagtgtgcaacttggcatt
aaaatttctgataaagaagcaaaaagtattgaaactttcttaaaatctttaacaggaaca
aaaccagcaattgtttatccacaacttcctatttctactgaaaaaactcctaaacctgaa
ctataa

DBGET integrated database retrieval system