KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0508Help
Entry
CJM1_0508         CDS       T01855                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
cjm00020  Citrate cycle (TCA cycle)
cjm00640  Propanoate metabolism
cjm00660  C5-Branched dibasic acid metabolism
cjm01100  Metabolic pathways
cjm01110  Biosynthesis of secondary metabolites
cjm01120  Microbial metabolism in diverse environments
cjm01130  Biosynthesis of antibiotics
cjm01200  Carbon metabolism
Module
cjm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJM1_0508 (sucC)
   00640 Propanoate metabolism
    CJM1_0508 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CJM1_0508 (sucC)
Enzymes [BR:cjm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CJM1_0508 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ADN90722
Position
492303..493466
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKAIFADNGIPTLKGKVAFSVDEAVSNAKELGGSVWAVKAQIHAGGRGLGGGV
KIAKNLDEVKDYASKILGMNLATHQTGPEGKLVQKLYIESGANIVKEYYLAILFNRMAEQ
ITIIASSEGGMDIEKVAKESPEKIAKVGIDPQIGFKMFHGLEVARVLGLDKDEGKKLISM
IAKLYKLYMDKDMNMLEINPLIKTAEGDFYALDAKCSFDDSALYRHPEIAELRDITEENP
AEREAAEFGLSYVKLDGDVACMVNGAGLAMATMDIINYSGAKPANFLDVGGGASPETVAK
AFEIILRDKNVKVIFINIFGGIVRCDRIANGILEATKNVEVNIPIVVRLDGTNAAEAKTI
LDNSNLKNIKAATNLKNGAELVKSLVG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacatgagtatcaagcaaaagcaatttttgcagacaatggcatccctacctta
aagggaaaagttgcatttagcgtagatgaagctgtatctaatgctaaagaattaggcggt
agtgtttgggcagttaaagctcaaattcacgcaggaggccgtggtcttggtggtggtgtt
aaaatcgctaagaatttagatgaggtaaaagattacgcaagtaaaattttaggaatgaat
ttagcaactcatcaaacaggacctgaaggtaagctcgtgcaaaaactttatatagaaagt
ggcgctaatatagtaaaagagtattatttggctattttatttaatagaatggcagagcaa
attaccattatcgcttcaagtgaaggagggatggatatagaaaaagtagccaaagaaagc
cctgaaaaaattgcaaaagtaggtattgatccacaaattggatttaaaatgtttcatgga
cttgaagtagcgagagttttaggacttgataaagatgaaggcaaaaaactcatttctatg
atagctaaactttataagctttacatggataaagatatgaatatgcttgaaatcaatcct
ttaattaaaactgcagaaggggatttttatgcccttgatgcaaaatgcagttttgatgat
agtgcgctttatcgtcatcctgagattgctgaacttagagatattactgaagaaaatcct
gctgaaagagaagcggctgaatttggcttaagctatgtgaaattagatggagatgtagct
tgtatggtaaatggtgcgggtctagcaatggcaactatggatattattaattatagtggt
gcaaaacctgcaaatttcttagatgtaggtgggggagcttctcctgaaactgttgcaaag
gcttttgaaatcattttaagagataagaatgtaaaagttatatttatcaatatctttggt
ggtattgttcgttgtgataggatagcaaatggaattttagaagctactaagaatgttgag
gtaaatattccaattgtagtgcgtcttgatggtactaacgcagcagaagcaaagacaatt
ttagataattcaaatcttaaaaatatcaaagcagcaaccaatcttaaaaacggtgcagag
cttgtaaaaagtttagtaggataa

DBGET integrated database retrieval system