KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0562Help
Entry
CJM1_0562         CDS       T01855                                 

Gene name
folP
Definition
dihydropteroate synthase (folP) (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538825..539967
Genome map
AA seq 380 aa AA seqDB search
MKFFKINPNTDFNLLCSFINPHKMGQKIMSEKTKIHFIFIKDISTPAANILKQDALRVGA
ELITHKEVITAKITHSNVLLMASKEQIQKLIVKEKLQDFGLKNLALFLQKDFLKPKKAEL
MAVINVNEDSFNAKSRVSEEDFEKRLNDFLALKPEYIDIGAVSSRPGSEYCGKEEEFKRL
KKVLDLIYEKNYYEQAIFSLDSFDEYCLEYALNKGFKLINDITSLRNLNLAKLASKYEAK
YCLMHMQNNPNNMQDNPFYEDLLDEMTLFFKEKLELLESFGVKESILDVGIGFGKSAGHN
MILIKHLEHFLQFNKPLLIGASRKSVINAYFQSEIKDRLAGTLYLHLKAFENGASIIRVH
DLYEHKQLFALAQAMDNIGV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttaaaatcaatccaaacaccgattttaatttgctttgttctttcataaac
cctcataaaatgggacaaaagattatgagtgaaaaaacaaaaattcattttatttttatc
aaagatatttctactcctgcggcaaatattttaaaacaagatgctttaagagtaggagct
gaacttattactcataaagaagtaattactgcaaaaatcactcattcaaatgtgctttta
atggcaagtaaagagcaaattcaaaagcttattgtcaaagaaaaacttcaagattttgga
cttaaaaatttggctctttttttgcaaaaagattttttaaaaccgaaaaaagccgagctt
atggcagtgattaatgttaatgaagacagttttaatgcaaaaagtcgtgtgagtgaagaa
gactttgaaaaaagacttaatgactttcttgctttaaagcctgaatatatcgatataggt
gcggttagttcaagacctgggagtgagtattgtggtaaggaagaggaatttaaaagactg
aaaaaagtacttgacttaatttatgagaaaaattattacgaacaagcaatttttagttta
gatagttttgatgaatattgtctagaatatgctttaaataagggttttaaactcattaat
gatattacaagtttaagaaatcttaatctagccaaacttgcaagtaagtatgaggcaaaa
tattgcttaatgcacatgcaaaacaatccaaataacatgcaagataatcctttttatgaa
gatttgcttgatgagatgactttgttttttaaagaaaaacttgagcttttagaaagtttt
ggagtaaaagaaagtattttagatgtaggtattggttttggaaagagtgcgggccataat
atgattttaatcaaacacttagaacattttttacaatttaataagcctttgcttataggt
gcgagtcgcaaaagtgtgattaatgcgtattttcaaagcgagattaaagatcgtttagca
ggaactttgtatttgcatttaaaggcttttgaaaatggtgctagtattataagagtgcat
gatttatatgagcacaaacaactttttgctttagcacaggcaatggataatataggagtt
tag

DBGET integrated database retrieval system