KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0789Help
Entry
CJM1_0789         CDS       T01855                                 

Gene name
thrC
Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cjm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CJM1_0789 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJM1_0789 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CJM1_0789 (thrC)
Enzymes [BR:cjm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CJM1_0789 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
763466..764878
Genome map
AA seq 470 aa AA seqDB search
MKLVESRNVKNVSSFKEALINPNAPEGGLYSPLNLPIFEGEKYANLSYKDFALKLIESFG
FGEEELFKKALKSYESFDDKNTPISLQKISEKTYINELWHGPTRAFKDMALQPFGVLLSE
FSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTSGVQELQMRALDKDNLKV
FAIDEDFDAAQRTLKELLFSKDFQNEIKALNYELCAANSVNFGRILFQIIYHYYASLKLF
NEFLEEVQIIVPSGNFGNALGAFYAKKMGAKISKIKIASNANNILSEFFNQGVYDLREKS
LKKTISPAMDILISSNIERLLFAKFKDKRTKELMNLLKNERYFKLEKEELQSLQEDFEAD
FCTDEECMQFIKQSKILIDPHTATCFKMLDPLKPSIITSTAEWTKFTPSMIKALYDRDSK
NEKEDLKFIAKEFNVQVKDEILTLFDLKNSDEKVFEARNIKKEILDWMQK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattggtcgagagtagaaatgtaaaaaatgtatcaagttttaaggaagctttgatt
aacccaaacgccccagaaggagggctttactcacctttaaatttgcctatttttgaagga
gaaaaatatgccaatttgtcttataaagattttgctttaaagcttatagaaagttttggt
tttggcgaagaagagctttttaaaaaggctttgaaaagttacgaaagctttgatgataaa
aatacacctatttctttgcaaaaaatctctgaaaaaacctatattaacgagctttggcat
ggacctacaagagcttttaaagatatggctttgcagccttttggcgtgcttttaagtgaa
ttttcaaaggataaaaatattttaattatttgtgctacaagcggcgatacaggacctgca
accctaaaaagctttgaaaatgcaaaaaatgttaaagtagcttgtatgtatccaaaaggt
ggcacaagtggagttcaagagttgcaaatgcgagctttagataaggataacttgaaagtt
tttgccatagatgaggattttgacgcagcgcaacgcactttaaaagaattgcttttttca
aaagattttcaaaatgaaattaaagctttaaattatgagctttgcgcagctaattctgta
aattttgggcgtattttatttcagattatttatcattattatgcgagtttaaaacttttt
aatgagtttttagaagaagtacaaatcatcgttccaagtggaaattttggcaatgcttta
ggagctttttatgctaaaaaaatgggagctaaaatttcaaaaatcaaaatcgcttcaaac
gcaaataatattttgagtgaattttttaatcaaggcgtttatgatttgcgtgaaaaaagt
cttaagaagactatttctccagctatggatatacttatttcatctaatatcgaaagactt
ttgtttgcgaaatttaaagataaaagaactaaagaactgatgaatttgttaaaaaatgag
agatattttaaacttgaaaaagaagaattacaaagtttgcaagaagattttgaggcggat
ttttgcaccgatgaagaatgtatgcaatttatcaaacaaagtaaaattttaattgatccg
cataccgcaacttgttttaaaatgcttgatcctttaaaacctagcattatcacttctaca
gcagaatggacaaaatttactccaagtatgataaaagctttatatgatagggattctaag
aatgaaaaagaagatttaaaatttatagctaaagagtttaatgtccaagttaaagatgaa
attttgactttatttgatttgaaaaatagcgatgaaaaggtatttgaagccagaaatata
aaaaaagaaattttagattggatgcaaaaatga

DBGET integrated database retrieval system